KEGG   Homo sapiens (human): 47Help
Entry
47                CDS       T01001                                 

Gene name
ACLY, ACL, ATPCL, CLATP
Definition
(RefSeq) ATP citrate lyase
  KO
K01648  ATP citrate (pro-S)-lyase [EC:2.3.3.8]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00020  Citrate cycle (TCA cycle)
hsa01100  Metabolic pathways
Drug target
Bempedoic acid: D10691
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    47 (ACLY)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    47 (ACLY)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.8  ATP citrate synthase
     47 (ACLY)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   47 (ACLY)
  Exosomal proteins of bladder cancer cells
   47 (ACLY)
  Exosomal proteins of melanoma cells
   47 (ACLY)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Citrate_bind Citrate_synt Ligase_CoA CoA_binding ATP-grasp_2 Succ_CoA_lig
Motif
Other DBs
NCBI-GeneID: 47
NCBI-ProteinID: NP_001087
OMIM: 108728
HGNC: 115
Ensembl: ENSG00000131473
Vega: OTTHUMG00000133507
Pharos: P53396(Tchem)
UniProt: P53396 A0A024R1T9
Structure
PDB: 

Position
17q21.2
AA seq 1101 aa AA seqDB search
MSAKAISEQTGKELLYKFICTTSAIQNRFKYARVTPDTDWARLLQDHPWLLSQNLVVKPD
QLIKRRGKLGLVGVNLTLDGVKSWLKPRLGQEATVGKATGFLKNFLIEPFVPHSQAEEFY
VCIYATREGDYVLFHHEGGVDVGDVDAKAQKLLVGVDEKLNPEDIKKHLLVHAPEDKKEI
LASFISGLFNFYEDLYFTYLEINPLVVTKDGVYVLDLAAKVDATADYICKVKWGDIEFPP
PFGREAYPEEAYIADLDAKSGASLKLTLLNPKGRIWTMVAGGGASVVYSDTICDLGGVNE
LANYGEYSGAPSEQQTYDYAKTILSLMTREKHPDGKILIIGGSIANFTNVAATFKGIVRA
IRDYQGPLKEHEVTIFVRRGGPNYQEGLRVMGEVGKTTGIPIHVFGTETHMTAIVGMALG
HRPIPNQPPTAAHTANFLLNASGSTSTPAPSRTASFSESRADEVAPAKKAKPAMPQDSVP
SPRSLQGKSTTLFSRHTKAIVWGMQTRAVQGMLDFDYVCSRDEPSVAAMVYPFTGDHKQK
FYWGHKEILIPVFKNMADAMRKHPEVDVLINFASLRSAYDSTMETMNYAQIRTIAIIAEG
IPEALTRKLIKKADQKGVTIIGPATVGGIKPGCFKIGNTGGMLDNILASKLYRPGSVAYV
SRSGGMSNELNNIISRTTDGVYEGVAIGGDRYPGSTFMDHVLRYQDTPGVKMIVVLGEIG
GTEEYKICRGIKEGRLTKPIVCWCIGTCATMFSSEVQFGHAGACANQASETAVAKNQALK
EAGVFVPRSFDELGEIIQSVYEDLVANGVIVPAQEVPPPTVPMDYSWARELGLIRKPASF
MTSICDERGQELIYAGMPITEVFKEEMGIGGVLGLLWFQKRLPKYSCQFIEMCLMVTADH
GPAVSGAHNTIICARAGKDLVSSLTSGLLTIGDRFGGALDAAAKMFSKAFDSGIIPMEFV
NKMKKEGKLIMGIGHRVKSINNPDMRVQILKDYVRQHFPATPLLDYALEVEKITTSKKPN
LILNVDGLIGVAFVDMLRNCGSFTREEADEYIDIGALNGIFVLGRSMGFIGHYLDQKRLK
QGLYRHPWDDISYVLPEHMSM
NT seq 3306 nt NT seq  +upstreamnt  +downstreamnt
atgtcggccaaggcaatttcagagcagacgggcaaagaactcctttacaagttcatctgt
accacctcagccatccagaatcggttcaagtatgctcgggtcactcctgacacagactgg
gcccgcttgctgcaggaccacccctggctgctcagccagaacttggtagtcaagccagac
cagctgatcaaacgtcgtggaaaacttggtctcgttggggtcaacctcactctggatggg
gtcaagtcctggctgaagccacggctgggacaggaagccacagttggcaaggccacaggc
ttcctcaagaactttctgatcgagcccttcgtcccccacagtcaggctgaggagttctat
gtctgcatctatgccacccgagaaggggactacgtcctgttccaccacgaggggggtgtg
gacgtgggtgatgtggacgccaaggcccagaagctgcttgttggcgtggatgagaaactg
aatcctgaggacatcaaaaaacacctgttggtccacgcccctgaagacaagaaagaaatt
ctggccagttttatctccggcctcttcaatttctacgaggacttgtacttcacctacctc
gagatcaatccccttgtagtgaccaaagatggagtctatgtccttgacttggcggccaag
gtggacgccactgccgactacatctgcaaagtgaagtggggtgacatcgagttccctccc
cccttcgggcgggaggcatatccagaggaagcctacattgcagacctcgatgccaaaagt
ggggcaagcctgaagctgaccttgctgaaccccaaagggaggatctggaccatggtggcc
gggggtggcgcctctgtcgtgtacagcgataccatctgtgatctagggggtgtcaacgag
ctggcaaactatggggagtactcaggcgcccccagcgagcagcagacctatgactatgcc
aagactatcctctccctcatgacccgagagaagcacccagatggcaagatcctcatcatt
ggaggcagcatcgcaaacttcaccaacgtggctgccacgttcaagggcatcgtgagagca
attcgagattaccagggccccctgaaggagcacgaagtcacaatctttgtccgaagaggt
ggccccaactatcaggagggcttacgggtgatgggagaagtcgggaagaccactgggatc
cccatccatgtctttggcacagagactcacatgacggccattgtgggcatggccctgggc
caccggcccatccccaaccagccacccacagcggcccacactgcaaacttcctcctcaac
gccagcgggagcacatcgacgccagcccccagcaggacagcatctttttctgagtccagg
gccgatgaggtggcgcctgcaaagaaggccaagcctgccatgccacaagattcagtccca
agtccaagatccctgcaaggaaagagcaccaccctcttcagccgccacaccaaggccatt
gtgtggggcatgcagacccgggccgtgcaaggcatgctggactttgactatgtctgctcc
cgagacgagccctcagtggctgccatggtctaccctttcactggggaccacaagcagaag
ttttactgggggcacaaagagatcctgatccctgtcttcaagaacatggctgatgccatg
aggaagcatccggaggtagatgtgctcatcaactttgcctctctccgctctgcctatgac
agcaccatggagaccatgaactatgcccagatccggaccatcgccatcatagctgaaggc
atccctgaggccctcacgagaaagctgatcaagaaggcggaccagaagggagtgaccatc
atcggacctgccactgttggaggcatcaagcctgggtgctttaagattggcaacacaggt
gggatgctggacaacatcctggcctccaaactgtaccgcccaggcagcgtggcctatgtc
tcacgttccggaggcatgtccaacgagctcaacaatatcatctctcggaccacggatggc
gtctatgagggcgtggccattggtggggacaggtacccgggctccacattcatggatcat
gtgttacgctatcaggacactccaggagtcaaaatgattgtggttcttggagagattggg
ggcactgaggaatataagatttgccggggcatcaaggagggccgcctcactaagcccatc
gtctgctggtgcatcgggacgtgtgccaccatgttctcctctgaggtccagtttggccat
gctggagcttgtgccaaccaggcttctgaaactgcagtagccaagaaccaggctttgaag
gaagcaggagtgtttgtgccccggagctttgatgagcttggagagatcatccagtctgta
tacgaagatctcgtggccaatggagtcattgtacctgcccaggaggtgccgcccccaacc
gtgcccatggactactcctgggccagggagcttggtttgatccgcaaacctgcctcgttc
atgaccagcatctgcgatgagcgaggacaggagctcatctacgcgggcatgcccatcact
gaggtcttcaaggaagagatgggcattggcggggtcctcggcctcctctggttccagaaa
aggttgcctaagtactcttgccagttcattgagatgtgtctgatggtgacagctgatcac
gggccagccgtctctggagcccacaacaccatcatttgtgcgcgagctgggaaagacctg
gtctccagcctcacctcggggctgctcaccatcggggatcggtttgggggtgccttggat
gcagcagccaagatgttcagtaaagcctttgacagtggcattatccccatggagtttgtg
aacaagatgaagaaggaagggaagctgatcatgggcattggtcaccgagtgaagtcgata
aacaacccagacatgcgagtgcagatcctcaaagattacgtcaggcagcacttccctgcc
actcctctgctcgattatgcactggaagtagagaagattaccacctcgaagaagccaaat
cttatcctgaatgtagatggtctcatcggagtcgcatttgtagacatgcttagaaactgt
gggtcctttactcgggaggaagctgatgaatatattgacattggagccctcaatggcatc
tttgtgctgggaaggagtatggggttcattggacactatcttgatcagaagaggctgaag
caggggctgtatcgtcatccgtgggatgatatttcatatgttcttccggaacacatgagc
atgtaa

DBGET integrated database retrieval system