KEGG   Homo sapiens (human): 4705Help
Entry
4705              CDS       T01001                                 

Gene name
NDUFA10, CI-42KD, CI-42k
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit A10
  KO
K03954  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 10
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Disease
H01354  Leigh syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4705 (NDUFA10)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    4705 (NDUFA10)
  09159 Environmental adaptation
   04714 Thermogenesis
    4705 (NDUFA10)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    4705 (NDUFA10)
   05012 Parkinson disease
    4705 (NDUFA10)
   05016 Huntington disease
    4705 (NDUFA10)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    4705 (NDUFA10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: dNK Thymidylate_kin Cytidylate_kin AAA_18
Motif
Other DBs
NCBI-GeneID: 4705
NCBI-ProteinID: NP_004535
OMIM: 603835
HGNC: 7684
Ensembl: ENSG00000130414
Vega: OTTHUMG00000133350
Pharos: O95299(Tclin)
UniProt: O95299 A0A024R4B3
Structure
PDB: 

Position
2q37.3
AA seq 355 aa AA seqDB search
MALRLLKLAATSASARVVAAGAQRVRGIHSSVQCKLRYGMWHFLLGDKASKRLTERSRVI
TVDGNICTGKGKLAKEIAEKLGFKHFPEAGIHYPDSTTGDGKPLATDYNGNCSLEKFYDD
PRSNDGNSYRLQSWLYSSRLLQYSDALEHLLTTGQGVVLERSIFSDFVFLEAMYNQGFIR
KQCVDHYNEVKSVTICDYLPPHLVIYIDVPVPEVQRRIQKKGDPHEMKITSAYLQDIENA
YKKTFLPEMSEKCEVLQYSAREAQDSKKVVEDIEYLKFDKGPWLKQDNRTLYHLRLLVQD
KFEVLNYTSIPIFLPEVTIGAHQTDRVLHQFRELPGRKYSPGYNTEVGDKWIWLK
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggccttgcggctcctgaagctggcagcgacgtccgcgtccgcccgggtcgtggcggcg
ggcgcccagcgcgtgagaggaattcatagcagtgtgcagtgcaaactgcgctatggaatg
tggcatttcctacttggggataaagcaagcaaaagactgacagaacgcagcagagtgata
actgtagatggcaatatatgtactggaaaaggcaaacttgcaaaagaaatagcagagaaa
ctaggcttcaagcactttcctgaagcggggattcattatccagacagtaccacaggagat
gggaagcccctcgccaccgactataatggcaactgtagtttggagaaattttacgatgat
ccgagaagcaatgatggcaacagttaccgcctgcagtcctggttgtacagcagtcgcctg
ctgcagtactcagatgccttggagcacttgctgaccacaggacaaggtgttgtgttggag
cgctccatcttcagtgactttgtgttcctggaggcgatgtacaaccagggattcatccga
aagcagtgtgtggaccactacaacgaggtgaagagcgtcaccatctgcgattacctgccc
ccccacctggtgatttacatcgatgtgcccgttccagaggtccagaggcggattcagaag
aaaggagatccacatgaaatgaagatcacctctgcctatctacaggacattgagaatgcc
tataagaaaacctttctccctgagatgagtgaaaaatgtgaggttttacaatattctgca
agggaagctcaagattcaaaaaaggtggtagaggacattgaatacctgaagttcgataaa
gggccgtggctcaagcaggacaatcgcactttataccacctgcgattactggttcaggat
aagtttgaggtgctgaattacacaagcattcctatctttctcccggaagtcaccattgga
gctcatcagactgaccgtgtcttacatcagttcagagagctgccgggccgcaagtacagc
cctgggtacaacaccgaggtgggagacaagtggatctggctgaagtga

DBGET integrated database retrieval system