KEGG   Homo sapiens (human): 4706Help
Entry
4706              CDS       T01001                                 

Gene name
NDUFAB1, ACP, ACP1, FASN2A, SDAP
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit AB1
  KO
K03955  NADH dehydrogenase (ubiquinone) 1 alpha/beta subcomplex 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4706 (NDUFAB1)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    4706 (NDUFAB1)
  09159 Environmental adaptation
   04714 Thermogenesis
    4706 (NDUFAB1)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    4706 (NDUFAB1)
   05012 Parkinson disease
    4706 (NDUFAB1)
   05016 Huntington disease
    4706 (NDUFAB1)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    4706 (NDUFAB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PP-binding PP-binding_2 MinE
Motif
Other DBs
NCBI-GeneID: 4706
NCBI-ProteinID: NP_004994
OMIM: 603836
HGNC: 7694
Ensembl: ENSG00000004779
Vega: OTTHUMG00000096985
Pharos: O14561(Tclin)
UniProt: O14561
Structure
PDB: 

Position
16p12.2
AA seq 156 aa AA seqDB search
MASRVLSAYVSRLPAAFAPLPRVRMLAVARPLSTALCSAGTQTRLGTLQPALVLAQVPGR
VTQLCRQYSDMPPLTLEGIQDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIM
AMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctcgtgtcctttcagcctatgtcagccgcctgcccgcggcctttgcgccgctg
ccccgggtccggatgctggccgtggcccggcctctcagcaccgctctctgctccgcgggg
acccagacgaggctcgggactttgcagccggccttagtgctcgcgcaggttcctggtaga
gttacacagttgtgccgccagtatagcgacatgcctcctttgacgttagagggcatccag
gaccgtgttctttacgtattgaaactctatgacaagattgacccagagaagctttcagta
aattctcattttatgaaagacctgggcttagacagtttggaccaagtggagattatcatg
gccatggaagacgaatttgggtttgaaattcctgatatagatgctgaaaagttaatgtgt
ccacaagaaattgtagattacattgcagataagaaggatgtatatgaataa

DBGET integrated database retrieval system