KEGG   Homo sapiens (human): 4711
Entry
4711              CDS       T01001                                 

Gene name
NDUFB5, CISGDH, SGDH
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit B5
  KO
K03961  NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04932  Non-alcoholic fatty liver disease
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
Module
hsa_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Network
nt06418  Oxidative phosphorylation
nt06460  Alzheimer disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
  Element
N00995  Electron transfer in Complex I
N00997  Mutation-caused aberrant Abeta to electron transfer in Complex I
N01042  Mutation-caused aberrant SNCA to electron transfer in Complex I
N01043  Mutation-inactivated PINK1 to electron transfer in Complex I
N01044  MPP+ to electron transfer in Complex I
N01045  Rotenone to electron transfer in Complex I
N01136  Mutation-caused aberrant TDP43 to electron transfer in Complex I
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4711 (NDUFB5)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    4711 (NDUFB5)
  09159 Environmental adaptation
   04714 Thermogenesis
    4711 (NDUFB5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    4711 (NDUFB5)
   05012 Parkinson disease
    4711 (NDUFB5)
   05014 Amyotrophic lateral sclerosis
    4711 (NDUFB5)
   05016 Huntington disease
    4711 (NDUFB5)
   05020 Prion disease
    4711 (NDUFB5)
   05022 Pathways of neurodegeneration - multiple diseases
    4711 (NDUFB5)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    4711 (NDUFB5)
SSDB
Motif
Pfam: NDUF_B5 VMA21 PanZ
Other DBs
NCBI-GeneID: 4711
NCBI-ProteinID: NP_002483
OMIM: 603841
HGNC: 7700
Ensembl: ENSG00000136521
Vega: OTTHUMG00000157480
Pharos: O43674(Tclin)
UniProt: O43674
Structure
PDB: 
5XTC 5XTD

Position
3q26.33
AA seq 189 aa
MAAMSLLRRVSVTAVAALSGRPLGTRLGFGGFLTRGFPKAAAPVRHSGDHGKRLFVIRPS
RFYDRRFLKLLRFYIALTGIPVAIFITLVNVFIGQAELAEIPEGYVPEHWEYYKHPISRW
IARNFYDSPEKIYERTMAVLQIEAEKAELRVKELEVRKLMHVRGDGPWYYYETIDKELID
HSPKATPDN
NT seq 570 nt   +upstreamnt  +downstreamnt
atggcggccatgagtttgttgcggcgggtttcggttactgcggtggcagctctgtctggc
cggccccttggcactcgcctcggatttgggggcttcctcactcgtggctttccgaaggct
gctgctcctgttcgacacagtggagaccatgggaaaagactatttgtcatcagaccttct
agattctatgacaggcgttttttgaagttattgagattctacattgcattgactgggatt
ccagtagcaattttcataactctggtgaatgtattcattggtcaagctgaactagcagaa
attccagaaggctatgtcccagaacactgggaatattataagcatcccatatcaagatgg
attgcccgtaatttctatgatagtcctgaaaagatatatgaaagaacaatggccgtcctt
cagattgaagctgaaaaggctgaattacgggtaaaggagctggaagtgcgaaaattgatg
catgtgagaggagatggaccctggtattactatgagacaattgacaaggaacttattgat
cattctccgaaagcaactcctgacaattaa

DBGET integrated database retrieval system