KEGG   Homo sapiens (human): 4711Help
Entry
4711              CDS       T01001                                 

Gene name
NDUFB5, CISGDH, SGDH
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit B5
  KO
K03961  NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4711 (NDUFB5)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    4711 (NDUFB5)
  09159 Environmental adaptation
   04714 Thermogenesis
    4711 (NDUFB5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    4711 (NDUFB5)
   05012 Parkinson disease
    4711 (NDUFB5)
   05016 Huntington disease
    4711 (NDUFB5)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    4711 (NDUFB5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NDUF_B5 PanZ
Motif
Other DBs
NCBI-GeneID: 4711
NCBI-ProteinID: NP_002483
OMIM: 603841
HGNC: 7700
Ensembl: ENSG00000136521
Vega: OTTHUMG00000157480
Pharos: O43674(Tclin)
UniProt: O43674
Structure
PDB: 

Position
3q26.33
AA seq 189 aa AA seqDB search
MAAMSLLRRVSVTAVAALSGRPLGTRLGFGGFLTRGFPKAAAPVRHSGDHGKRLFVIRPS
RFYDRRFLKLLRFYIALTGIPVAIFITLVNVFIGQAELAEIPEGYVPEHWEYYKHPISRW
IARNFYDSPEKIYERTMAVLQIEAEKAELRVKELEVRKLMHVRGDGPWYYYETIDKELID
HSPKATPDN
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggcggccatgagtttgttgcggcgggtttcggttactgcggtggcagctctgtctggc
cggccccttggcactcgcctcggatttgggggcttcctcactcgtggctttccgaaggct
gctgctcctgttcgacacagtggagaccatgggaaaagactatttgtcatcagaccttct
agattctatgacaggcgttttttgaagttattgagattctacattgcattgactgggatt
ccagtagcaattttcataactctggtgaatgtattcattggtcaagctgaactagcagaa
attccagaaggctatgtcccagaacactgggaatattataagcatcccatatcaagatgg
attgcccgtaatttctatgatagtcctgaaaagatatatgaaagaacaatggccgtcctt
cagattgaagctgaaaaggctgaattacgggtaaaggagctggaagtgcgaaaattgatg
catgtgagaggagatggaccctggtattactatgagacaattgacaaggaacttattgat
cattctccgaaagcaactcctgacaattaa

DBGET integrated database retrieval system