KEGG   Homo sapiens (human): 4712Help
Entry
4712              CDS       T01001                                 

Gene name
NDUFB6, B17, CI
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit B6
  KO
K03962  NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer's disease
hsa05012  Parkinson's disease
hsa05016  Huntington's disease
Module
hsa_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    4712 (NDUFB6)
 Organismal Systems
  Nervous system
   04723 Retrograde endocannabinoid signaling
    4712 (NDUFB6)
  Environmental adaptation
   04714 Thermogenesis
    4712 (NDUFB6)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    4712 (NDUFB6)
   05012 Parkinson's disease
    4712 (NDUFB6)
   05016 Huntington's disease
    4712 (NDUFB6)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    4712 (NDUFB6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NDUF_B6 Sensor
Motif
Other DBs
NCBI-GeneID: 4712
NCBI-ProteinID: NP_002484
OMIM: 603322
HGNC: 7701
Ensembl: ENSG00000165264
Vega: OTTHUMG00000019741
Pharos: O95139(Tclin)
UniProt: O95139
Structure
PDB: 

Position
9p21.1
AA seq 128 aa AA seqDB search
MTGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPQKMGPMEKFWNKFLENKSPWRKM
VHGVYKKSIFVFTHVLVPVWIIHYYMKYHVSEKPYGIVEKKSRIFPGDTILETGEVIPPM
KEFPDQHH
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgacggggtacactccggatgagaaactgcggctgcagcagctgcgagagctgagaagg
cgatggctgaaggaccaggagctgagccctcgggagccggtgctgcccccacagaagatg
gggcctatggagaaattctggaataaatttttggagaataaatccccttggaggaaaatg
gtccatggggtatacaaaaagagtatctttgttttcactcatgtacttgtacctgtctgg
attattcattattacatgaagtatcatgtttctgaaaaaccatatggcatagttgaaaag
aagtccagaatattccctggtgatacaattctggagactggagaagtaattccaccaatg
aaagaatttcctgatcaacatcattaa

DBGET integrated database retrieval system