KEGG   Homo sapiens (human): 4717
Entry
4717              CDS       T01001                                 

Gene name
NDUFC1, KFYI
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit C1
  KO
K03967  NADH dehydrogenase (ubiquinone) 1 subunit C1
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Network
nt06418  Oxidative phosphorylation
nt06460  Alzheimer disease
nt06463  Parkinson disease
  Element
N00995  Electron transfer in Complex I
N00997  Mutation-caused aberrant Abeta to electron transfer in Complex I
N01042  Mutation-caused aberrant SNCA to electron transfer in Complex I
N01043  Mutation-inactivated PINK1 to electron transfer in Complex I
N01044  MPP+ to electron transfer in Complex I
N01045  Rotenone to electron transfer in Complex I
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4717 (NDUFC1)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    4717 (NDUFC1)
  09159 Environmental adaptation
   04714 Thermogenesis
    4717 (NDUFC1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    4717 (NDUFC1)
   05012 Parkinson disease
    4717 (NDUFC1)
   05016 Huntington disease
    4717 (NDUFC1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    4717 (NDUFC1)
SSDB
Motif
Pfam: NADH_dh_m_C1
Other DBs
NCBI-GeneID: 4717
NCBI-ProteinID: NP_001171915
OMIM: 603844
HGNC: 7705
Ensembl: ENSG00000109390
Vega: OTTHUMG00000133387
Pharos: O43677(Tclin)
UniProt: O43677
Structure
PDB: 
5XTC 5XTD

Position
4q31.1
AA seq 76 aa
MAPSALLRPLSRLLAPARLPSGPSVRSKFYVREPPNAKPDWLKVGFTLGTTVFLWIYLIK
QHNEDILEYKRRNGLE
NT seq 231 nt   +upstreamnt  +downstreamnt
atggcgccgtccgccttgctgcgtcccctttcccggctgctggcccccgccaggctcccg
agcggcccttcagtgcgatcaaagttctacgtgcgagagccgccgaatgccaaacctgac
tggctgaaagttgggttcaccttgggcaccactgtcttcttgtggatctatctcatcaaa
caacacaatgaagatattttagagtacaaaagaagaaatgggctggaataa

DBGET integrated database retrieval system