KEGG   Homo sapiens (human): 4729Help
Entry
4729              CDS       T01001                                 

Gene name
NDUFV2, CI-24k
Definition
(RefSeq) NADH:ubiquinone oxidoreductase core subunit V2
  KO
K03943  NADH dehydrogenase (ubiquinone) flavoprotein 2 [EC:1.6.5.3 1.6.99.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Disease
H00473  Mitochondrial complex I deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4729 (NDUFV2)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    4729 (NDUFV2)
  09159 Environmental adaptation
   04714 Thermogenesis
    4729 (NDUFV2)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    4729 (NDUFV2)
   05012 Parkinson disease
    4729 (NDUFV2)
   05016 Huntington disease
    4729 (NDUFV2)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    4729 (NDUFV2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.3  NADH:ubiquinone reductase (H+-translocating)
     4729 (NDUFV2)
   1.6.99  With unknown physiological acceptors
    1.6.99.3  NADH dehydrogenase
     4729 (NDUFV2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2Fe-2S_thioredx
Motif
Other DBs
NCBI-GeneID: 4729
NCBI-ProteinID: NP_066552
OMIM: 600532
HGNC: 7717
Ensembl: ENSG00000178127
Vega: OTTHUMG00000131593
Pharos: P19404(Tclin)
UniProt: P19404
Structure
PDB: 

Position
18p11.22
AA seq 249 aa AA seqDB search
MFFSAALRARAAGLTAHWGRHVRNLHKTVMQNGAGGALFVHRDTPENNPDTPFDFTPENY
KRIEAIVKNYPEGHKAAAVLPVLDLAQRQNGWLPISAMNKVAEVLQVPPMRVYEVATFYT
MYNRKPVGKYHIQVCTTTPCMLRNSDSILEAIQKKLGIKVGETTPDKLFTLIEVECLGAC
VNAPMVQINDNYYEDLTAKDIEEIIDELKAGKIPKPGPRSGRFSCEPAGGLTSLTEPPKG
PGFGVQAGL
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgttcttctccgcggcgctccgggcccgggcggctggcctcaccgcccactggggaaga
catgtaaggaatttgcataagacagttatgcaaaatggagctggaggagctttatttgtg
cacagagatactcctgagaataaccctgatactccatttgatttcacaccagaaaactat
aagaggatagaggcaattgtaaaaaactatccagaaggccataaagcagcagctgttctt
ccagtcctggatttagcccaaaggcagaatgggtggttgcccatctctgctatgaacaag
gttgcagaagttttacaagtacctccaatgagagtatatgaagtagcaactttttataca
atgtataatcgaaagccagttggaaagtatcacattcaggtctgcactactacaccctgc
atgcttcgaaactctgacagcatactggaggccattcagaaaaagcttggaataaaggtt
ggggagactacacctgacaaacttttcactcttatagaagtggaatgtttaggggcctgt
gtgaacgcaccaatggttcaaataaatgacaattactatgaggatttgacagctaaggat
attgaagaaattattgatgagctcaaggctggcaaaatcccaaaaccagggccaaggagt
ggacgcttctcttgtgagccagctggaggtcttacctctttgactgaaccacccaaggga
cctggatttggtgtacaagcaggcctttaa

DBGET integrated database retrieval system