KEGG   Homo sapiens (human): 4738Help
Entry
4738              CDS       T01001                                 

Gene name
NEDD8, NEDD-8
Definition
(RefSeq) NEDD8 ubiquitin like modifier
  KO
K12158  ubiquitin-like protein Nedd8
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    4738 (NEDD8)
Ubiquitin system [BR:hsa04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   4738 (NEDD8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ubiquitin Rad60-SLD Ubiquitin_2 TBK1_ULD Rad60-SLD_2
Motif
Other DBs
NCBI-GeneID: 4738
NCBI-ProteinID: NP_006147
OMIM: 603171
HGNC: 7732
Ensembl: ENSG00000129559
Vega: OTTHUMG00000029325
Pharos: Q15843(Tbio)
UniProt: Q15843
Structure
PDB: 

Position
14q12
AA seq 81 aa AA seqDB search
MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYK
ILGGSVLHLVLALRGGGGLRQ
NT seq 246 nt NT seq  +upstreamnt  +downstreamnt
atgctaattaaagtgaagacgctgaccggaaaggagattgagattgacattgaacctaca
gacaaggtggagcgaatcaaggagcgtgtggaggagaaagagggaatccccccacaacag
cagaggctcatctacagtggcaagcagatgaatgatgagaagacagcagctgattacaag
attttaggtggttcagtccttcacctggtgttggctctgagaggaggaggtggtcttagg
cagtga

DBGET integrated database retrieval system