KEGG   Homo sapiens (human): 4739Help
Entry
4739              CDS       T01001                                 

Gene name
NEDD9, CAS-L, CAS2, CASL, CASS2, HEF1
Definition
(RefSeq) neural precursor cell expressed, developmentally down-regulated 9
  KO
K16832  enhancer of filamentation 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    4739 (NEDD9)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     4739 (NEDD9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CAS_C Serine_rich SH3_9 SH3_2 SH3_1
Motif
Other DBs
NCBI-GeneID: 4739
NCBI-ProteinID: NP_001135865
OMIM: 602265
HGNC: 7733
Ensembl: ENSG00000111859
Vega: OTTHUMG00000014255
Pharos: Q14511(Tbio)
UniProt: Q14511 A0A024QZV9
Structure
PDB: 

Position
6p24.2
AA seq 834 aa AA seqDB search
MWTRNLMARALYDNVPECAEELAFRKGDILTVIEQNTGGLEGWWLCSLHGRQGIVPGNRV
KLLIGPMQETASSHEQPASGLMQQTFGQQKLYQVPNPQAAPRDTIYQVPPSYQNQGIYQV
PTGHGTQEQEVYQVPPSVQRSIGGTSGPHVGKKVITPVRTGHGYVYEYPSRYQKDVYDIP
PSHTTQGVYDIPPSSAKGPVFSVPVGEIKPQGVYDIPPTKGVYAIPPSACRDEAGLREKD
YDFPPPMRQAGRPDLRPEGVYDIPPTCTKPAGKDLHVKYNCDIPGAAEPVARRHQSLSPN
HPPPQLGQSVGSQNDAYDVPRGVQFLEPPAETSEKANPQERDGVYDVPLHNPPDAKGSRD
LVDGINRLSFSSTGSTRSNMSTSSTSSKESSLSASPAQDKRLFLDPDTAIERLQRLQQAL
EMGVSSLMALVTTDWRCYGYMERHINEIRTAVDKVELFLKEYLHFVKGAVANAACLPELI
LHNKMKRELQRVEDSHQILSQTSHDLNECSWSLNILAINKPQNKCDDLDRFVMVAKTVPD
DAKQLTTTINTNAEALFRPGPGSLHLKNGPESIMNSTEYPHGGSQGQLLHPGDHKAQAHN
KALPPGLSKEQAPDCSSSDGSERSWMDDYDYVHLQGKEEFERQQKELLEKENIMKQNKMQ
LEHHQLSQFQLLEQEITKPVENDISKWKPSQSLPTTNSGVSAQDRQLLCFYYDQCETHFI
SLLNAIDALFSCVSSAQPPRIFVAHSKFVILSAHKLVFIGDTLTRQVTAQDIRNKVMNSS
NQLCEQLKTIVMATKMAALHYPSTTALQEMVHQVTDLSRNAQLFKRSLLEMATF
NT seq 2505 nt NT seq  +upstreamnt  +downstreamnt
atgtggacaaggaatcttatggcaagggccttatatgacaatgtcccagagtgtgccgag
gaactggcctttcgcaagggagacatcctgaccgtcatagagcagaacacagggggactg
gaaggatggtggctgtgctcattacacggtcggcaaggcattgtcccaggcaaccgggtg
aagcttctgattggtcccatgcaggagactgcctccagtcacgagcagcctgcctctgga
ctgatgcagcagacctttggccaacagaagctctatcaagtgccaaacccacaggctgct
ccccgagacaccatctaccaagtgccaccttcctaccaaaatcagggaatttaccaagtc
cccactggccacggcacccaagaacaagaggtatatcaggtgccaccatcagtgcagaga
agcattgggggaaccagtgggccccacgtgggtaaaaaggtgataacccccgtgaggaca
ggccatggctacgtatacgagtacccatccagataccaaaaggacgtctatgatatccct
ccttctcataccactcaaggggtatacgacatccctccctcatcagcaaaaggccctgtg
ttttcagttccagtgggagagataaaacctcaaggggtgtatgacatcccgcctacaaaa
ggggtatatgccattccgccctctgcttgccgggatgaagcagggcttagggaaaaagac
tatgacttcccccctcccatgagacaagctggaaggccggacctcagaccggagggggtt
tatgacattcctccaacctgcaccaagccagcagggaaggaccttcatgtaaaatacaac
tgtgacattccaggagctgcagaaccggtggctcgaaggcaccagagcctgtccccgaat
cacccacccccgcaactcggacagtcagtgggctctcagaacgacgcatatgatgtcccc
cgaggcgttcagtttcttgagccaccagcagaaaccagtgagaaagcaaacccccaggaa
agggatggtgtttatgatgtccctctgcataacccgccagatgctaaaggctctcgggac
ttggtggatgggatcaaccgattgtctttctccagtacaggcagcacccggagtaacatg
tccacgtcttccacctcctccaaggagtcctcactgtcagcctccccagctcaggacaaa
aggctcttcctggatccagacacagctattgagagacttcagcggctccagcaggccctt
gagatgggtgtctccagcctaatggcactggtcactaccgactggcggtgttacggatat
atggaaagacacatcaatgaaatacgcacagcagtggacaaggtggagctgttcctgaag
gagtacctccactttgtcaagggagctgttgcaaatgctgcctgcctcccggaactcatc
ctccacaacaagatgaagcgggagctgcaacgagttgaagactcccaccagatcctgagt
caaaccagccatgacttaaatgagtgcagctggtccctgaatatcttggccatcaacaag
ccccagaacaagtgtgacgatctggaccggtttgtgatggtggcaaagacggtgcccgat
gacgccaagcagctcaccacaaccatcaacaccaacgcagaggccctcttcagacccggc
cctggcagcttgcatctgaagaatgggccggagagcatcatgaactcaacggagtaccca
cacggtggctcccagggacagctgctgcatcctggtgaccacaaggcccaggcccacaac
aaggcactgcccccaggcctgagcaaggagcaggcccctgactgtagcagcagtgatggt
tctgagaggagctggatggatgactacgattacgtccacctacagggtaaggaggagttt
gagaggcaacagaaagagctattggaaaaagagaatatcatgaaacagaacaagatgcag
ctggaacatcatcagctgagccagttccagctgttggaacaagagattacaaagcccgtg
gagaatgacatctcgaagtggaagccctctcagagcctacccaccacaaacagtggcgtg
agtgctcaggatcggcagttgctgtgcttctactatgaccaatgtgagacccatttcatt
tcccttctcaacgccattgacgcactcttcagttgtgtcagctcagcccagcccccgcga
atcttcgtggcacacagcaagtttgtcatcctcagtgcacacaaactggtgttcattgga
gacacgctgacacggcaggtgactgcccaggacattcgcaacaaagtcatgaactccagc
aaccagctctgcgagcagctcaagaccatagtcatggcaaccaagatggccgccctccat
taccccagcaccacggccctgcaggaaatggtgcaccaagtgacagacctttctagaaat
gcccagctgttcaagcgctctttgctggagatggcaacgttctga

DBGET integrated database retrieval system