KEGG   Homo sapiens (human): 4758Help
Entry
4758              CDS       T01001                                 

Gene name
NEU1, NANH, NEU, SIAL1
Definition
(RefSeq) neuraminidase 1
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00511  Other glycan degradation
hsa00600  Sphingolipid metabolism
hsa04142  Lysosome
Disease
H00142  Sialidosis
H00276  Galactosialidosis
H00422  Glycoproteinoses
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    4758 (NEU1)
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    4758 (NEU1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    4758 (NEU1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:hsa02042]
    4758 (NEU1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     4758 (NEU1)
Bacterial toxins [BR:hsa02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   4758 (NEU1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BNR_2 BNR_3
Motif
Other DBs
NCBI-GeneID: 4758
NCBI-ProteinID: NP_000425
OMIM: 608272
HGNC: 7758
Ensembl: ENSG00000204386
Vega: OTTHUMG00000031284
Pharos: Q99519(Tbio)
UniProt: Q99519 Q5JQI0
Position
6p21.33
AA seq 415 aa AA seqDB search
MTGERPSTALPDRRWGPRILGFWGGCRVWVFAAIFLLLSLAASWSKAENDFGLVQPLVTM
EQLLWVSGRQIGSVDTFRIPLITATPRGTLLAFAEARKMSSSDEGAKFIALRRSMDQGST
WSPTAFIVNDGDVPDGLNLGAVVSDVETGVVFLFYSLCAHKAGCQVASTMLVWSKDDGVS
WSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHGTLERDGVFCLLSDDHGASW
RYGSGVSGIPYGQPKQENDFNPDECQPYELPDGSVVINARNQNNYHCHCRIVLRSYDACD
TLRPRDVTFDPELVDPVVAAGAVVTSSGIVFFSNPAHPEFRVNLTLRWSFSNGTSWRKET
VQLWPGPSGYSSLATLEGSMDGEEQAPQLYVLYEKGRNHYTESISVAKISVYGTL
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgactggggagcgacccagcacggcgctcccggacagacgctgggggccgcggattctg
ggcttctggggaggctgtagggtttgggtgtttgccgcgatcttcctgctgctgtctctg
gcagcctcctggtccaaggctgagaacgacttcggtctggtgcagccgctggtgaccatg
gagcaactgctgtgggtgagcgggagacagatcggctcagtggacaccttccgcatcccg
ctcatcacagccactccgcggggcactcttctcgcctttgctgaggcgaggaaaatgtcc
tcatccgatgagggggccaagttcatcgccctgcggaggtccatggaccagggcagcaca
tggtctcctacagcgttcattgtcaatgatggggatgtccccgatgggctgaaccttggg
gcagtagtgagcgatgttgagacaggagtagtatttcttttctactccctttgtgctcac
aaggccggctgccaggtggcctctaccatgttggtatggagcaaggatgatggtgtttcc
tggagcacaccccggaatctctccctggatattggcactgaagtgtttgcccctggaccg
ggctctggtattcagaaacagcgggagccacggaagggccgcctcatcgtgtgtggccat
gggacgctggagcgggacggagtcttctgtctcctcagcgatgatcatggtgcctcctgg
cgctacggaagtggggtcagcggcatcccctacggtcagcccaagcaggaaaatgatttc
aatcctgatgaatgccagccctatgagctcccagatggctcagtcgtcatcaatgcccga
aaccagaacaactaccactgccactgccgaattgtcctccgcagctatgatgcctgtgat
acactaaggccccgtgatgtgaccttcgaccctgagctcgtggaccctgtggtagctgca
ggagctgtagtcaccagctccggcattgtcttcttctccaacccagcacatccagagttc
cgagtgaacctgaccctgcgatggagcttcagcaatggtacctcatggcggaaagagaca
gtccagctatggccaggccccagtggctattcatccctggcaaccctggagggcagcatg
gatggagaggagcaggccccccagctctacgtcctgtatgagaaaggccggaaccactac
acagagagcatctccgtggccaaaatcagtgtctatgggacactctga

DBGET integrated database retrieval system