KEGG   Homo sapiens (human): 4775Help
Entry
4775              CDS       T01001                                 

Gene name
NFATC3, NFAT4, NFATX
Definition
(RefSeq) nuclear factor of activated T cells 3
  KO
K17333  nuclear factor of activated T-cells, cytoplasmic 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04218  Cellular senescence
hsa04310  Wnt signaling pathway
hsa04360  Axon guidance
hsa04625  C-type lectin receptor signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa04662  B cell receptor signaling pathway
hsa04921  Oxytocin signaling pathway
hsa05161  Hepatitis B
hsa05163  Human cytomegalovirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05170  Human immunodeficiency virus 1 infection
Network
N00147  EGF-EGFR-PLCG-calcineurin signaling pathway
N00172  KSHV K15 to PLCG-calcineurin signaling pathway
N00180  KSHV K1 to PLCG-calcineurin signaling pathway
N00401  CXCR4-GNAQ-PLCB/G-calcineurin signaling pathway
N00402  HCMV US28 to GNAQ-PLCB/G-calcineurin signaling pathway
N00432  HIV gp120 to CXCR4-GNAQ-PLCB/G-calcineurin
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    4775 (NFATC3)
   04310 Wnt signaling pathway
    4775 (NFATC3)
   04022 cGMP - PKG signaling pathway
    4775 (NFATC3)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    4775 (NFATC3)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    4775 (NFATC3)
   04660 T cell receptor signaling pathway
    4775 (NFATC3)
   04658 Th1 and Th2 cell differentiation
    4775 (NFATC3)
   04659 Th17 cell differentiation
    4775 (NFATC3)
   04662 B cell receptor signaling pathway
    4775 (NFATC3)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    4775 (NFATC3)
  09158 Development
   04360 Axon guidance
    4775 (NFATC3)
 09160 Human Diseases
  09167 Infectious diseases
   05166 HTLV-I infection
    4775 (NFATC3)
   05161 Hepatitis B
    4775 (NFATC3)
   05163 Human cytomegalovirus infection
    4775 (NFATC3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    4775 (NFATC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    4775 (NFATC3)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    4775 (NFATC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RHD_dimer RHD_DNA_bind TIG
Motif
Other DBs
NCBI-GeneID: 4775
NCBI-ProteinID: NP_775188
OMIM: 602698
HGNC: 7777
Ensembl: ENSG00000072736
Vega: OTTHUMG00000137555
Pharos: Q12968(Tbio)
UniProt: Q12968 B5B2S1
Position
16q22.1
AA seq 1075 aa AA seqDB search
MTTANCGAHDELDFKLVFGEDGAPAPPPPGSRPADLEPDDCASIYIFNVDPPPSTLTTPL
CLPHHGLPSHSSVLSPSFQLQSHKNYEGTCEIPESKYSPLGGPKPFECPSIQITSISPNC
HQELDAHEDDLQINDPEREFLERPSRDHLYLPLEPSYRESSLSPSPASSISSRSWFSDAS
SCESLSHIYDDVDSELNEAAARFTLGSPLTSPGGSPGGCPGEETWHQQYGLGHSLSPRQS
PCHSPRSSVTDENWLSPRPASGPSSRPTSPCGKRRHSSAEVCYAGSLSPHHSPVPSPGHS
PRGSVTEDTWLNASVHGGSGLGPAVFPFQYCVETDIPLKTRKTSEDQAAILPGKLELCSD
DQGSLSPARETSIDDGLGSQYPLKKDSCGDQFLSVPSPFTWSKPKPGHTPIFRTSSLPPL
DWPLPAHFGQCELKIEVQPKTHHRAHYETEGSRGAVKASTGGHPVVKLLGYNEKPINLQM
FIGTADDRYLRPHAFYQVHRITGKTVATASQEIIIASTKVLEIPLLPENNMSASIDCAGI
LKLRNSDIELRKGETDIGRKNTRVRLVFRVHIPQPSGKVLSLQIASIPVECSQRSAQELP
HIEKYSINSCSVNGGHEMVVTGSNFLPESKIIFLEKGQDGRPQWEVEGKIIREKCQGAHI
VLEVPPYHNPAVTAAVQVHFYLCNGKRKKSQSQRFTYTPVLMKQEHREEIDLSSVPSLPV
PHPAQTQRPSSDSGCSHDSVLSGQRSLICSIPQTYASMVTSSHLPQLQCRDESVSKEQHM
IPSPIVHQPFQVTPTPPVGSSYQPMQTNVVYNGPTCLPINAASSQEFDSVLFQQDATLSG
LVNLGCQPLSSIPFHSSNSGSTGHLLAHTPHSVHTLPHLQSMGYHCSNTGQRSLSSPVAD
QITGQPSSQLQPITYGPSHSGSATTASPAASHPLASSPLSGPPSPQLQPMPYQSPSSGTA
SSPSPATRMHSGQHSTQAQSTGQGGLSAPSSLICHSLCDPASFPPDGATVSIKPEPEDRE
PNFATIGLQDITLDDVNEIIGRDMSQISVSQGAGVSRQAPLPSPESLDLGRSDGL
NT seq 3228 nt NT seq  +upstreamnt  +downstreamnt
atgactactgcaaactgtggcgcccacgacgagctcgacttcaaactcgtctttggcgag
gacggggcgccggcgccgccgcccccgggctcgcggcctgcagatcttgagccagatgat
tgtgcatccatttacatctttaatgtagatccacctccatctactttaaccacaccactt
tgcttaccacatcatggattaccgtctcactcttctgttttgtcaccatcgtttcagctc
caaagtcacaaaaactatgaaggaacttgtgagattcctgaatctaaatatagcccatta
ggtggtcccaaaccctttgagtgcccaagtattcaaattacatctatctctcctaactgt
catcaagaattagatgcacatgaagatgacctacagataaatgacccagaacgggaattt
ttggaaaggccttctagagatcatctctatcttcctcttgagccatcctaccgggagtct
tctcttagtcctagtcctgccagcagcatctcttctaggagttggttctctgatgcatct
tcttgtgaatcgctttcacatatttatgatgatgtggactcagagttgaatgaagctgca
gcccgatttacccttggatcccctctgacttctcctggtggctctccagggggctgccct
ggagaagaaacttggcatcaacagtatggacttggacactcattatcacccaggcaatct
ccttgccactctcctagatccagtgtcactgatgagaattggctgagccccaggccagcc
tcaggaccctcatcaaggcccacatccccctgtgggaaacggaggcactccagtgctgaa
gtttgttatgctgggtccctttcaccccatcactcacctgttccttcacctggtcactcc
cccaggggaagtgtgacagaagatacgtggctcaatgcttctgtccatggtgggtcaggc
cttggccctgcagtttttccatttcagtactgtgtagagactgacatccctctcaaaaca
aggaaaacttctgaagatcaagctgccatactaccaggaaaattagagctgtgttcagat
gaccaagggagtttatcaccagcccgggagacttcaatagatgatggccttggatctcag
tatcctttaaagaaagattcatgtggtgatcagtttctttcagttccttcaccctttacc
tggagcaaaccaaagcctggccacacccctatatttcgcacatcttcattacctccacta
gactggcctttaccagctcattttggacaatgtgaactgaaaatagaagtgcaacctaaa
actcatcatcgagcccattatgaaactgaaggtagccgaggggcagtaaaagcatctact
gggggacatcctgttgtgaagctcctgggctataacgaaaagccaataaatctacaaatg
tttattgggacagcagatgatcgatatttacgacctcatgcattttaccaggtgcatcga
atcactgggaagacagtcgctactgcaagccaagagataataattgccagtacaaaagtt
ctggaaattccacttcttcctgaaaataatatgtcagccagtattgattgtgcaggtatt
ttgaaactccgcaattcagatatagaacttcgaaaaggagaaactgatattggcagaaag
aatactagagtacgacttgtgtttcgtgtacacatcccacagcccagtggaaaagtcctt
tctctgcagatagcctctatacccgttgagtgctcccagcggtctgctcaagaacttcct
catattgagaagtacagtatcaacagttgttctgtaaatggaggtcatgaaatggttgtg
actggatctaattttcttccagaatccaaaatcatttttcttgaaaaaggacaagatgga
cgacctcagtgggaggtagaagggaagataatcagggaaaaatgtcaaggggctcacatt
gtccttgaagttcctccatatcataacccagcagttacagctgcagtgcaggtgcacttt
tatctttgcaatggcaagaggaaaaaaagccagtctcaacgttttacttatacaccagtt
ttgatgaagcaagaacacagagaagagattgatttgtcttcagttccatctttgcctgtg
cctcatcctgctcagacccagaggccttcctctgattcagggtgttcacatgacagtgta
ctgtcaggacagagaagtttgatttgctccatcccacaaacatatgcatccatggtgacc
tcatcccatctgccacagttgcagtgtagagatgagagtgttagtaaagaacagcatatg
attccttctccaattgtacaccagccttttcaagtcacaccaacacctcctgtggggtct
tcctatcagcctatgcaaactaatgttgtgtacaatggaccaacttgtcttcctattaat
gctgcctctagtcaagaatttgattcagttttgtttcagcaggatgcaactctttctggt
ttagtgaatcttggctgtcaaccactgtcatccataccatttcattcttcaaattcaggc
tcaacaggacatctcttagcccatacacctcattctgtgcataccctgcctcatctgcaa
tcaatgggatatcattgttcaaatacaggacaaagatctctttcttctccagtggctgac
cagattacaggtcagccttcgtctcagttacaacctattacatatggtccttcacattca
gggtctgctacaacagcttccccagcagcttctcatcccttggctagttcaccgctttct
gggccaccatctcctcagcttcagcctatgccttaccaatctcctagctcaggaactgcc
tcatcaccgtctccagccaccagaatgcattctggacagcactcaactcaagcacaaagt
acgggccaggggggtctttctgcaccttcatccttaatatgtcacagtttgtgtgatcca
gcgtcatttccacctgatggggcaactgtgagcattaaacctgaaccagaagatcgagag
cctaactttgcaaccattggtctgcaggacatcactttagatgatgtgaacgagataatt
gggagagacatgtcccagatttctgtttcccaaggagcaggggtgagcaggcaggctccc
ctcccgagtcctgagtccctggatttaggaagatctgatgggctctaa

DBGET integrated database retrieval system