KEGG   Homo sapiens (human): 4780Help
Entry
4780              CDS       T01001                                 

Gene name
NFE2L2, HEBP1, IMDDHH, NRF2
Definition
(RefSeq) nuclear factor, erythroid 2 like 2
  KO
K05638  nuclear factor erythroid 2-related factor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
hsa05200  Pathways in cancer
hsa05225  Hepatocellular carcinoma
hsa05418  Fluid shear stress and atherosclerosis
Network
N00243  KEAP1-NRF2 signaling pathway
N00244  Mutation-inactivated KEAP1 to KEAP1-NRF2 signaling pathway
N00245  Mutation-activated NRF2 to KEAP1-NRF2 signaling pathway
Disease
H00048  Hepatocellular carcinoma
Drug target
Omaveloxolone: D10964
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    4780 (NFE2L2)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    4780 (NFE2L2)
  09162 Cancers: Specific types
   05225 Hepatocellular carcinoma
    4780 (NFE2L2)
  09166 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    4780 (NFE2L2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    4780 (NFE2L2)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    4780 (NFE2L2)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, NF-E2
    4780 (NFE2L2)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Nuclear respiratory factors
    4780 (NFE2L2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_Maf bZIP_1 bZIP_2 T3SS_basalb_I
Motif
Other DBs
NCBI-GeneID: 4780
NCBI-ProteinID: NP_006155
OMIM: 600492
HGNC: 7782
Ensembl: ENSG00000116044
Vega: OTTHUMG00000133620
Pharos: Q16236(Tchem)
UniProt: Q16236
Structure
PDB: 

Position
2q31.2
AA seq 605 aa AA seqDB search
MMDLELPPPGLPSQQDMDLIDILWRQDIDLGVSREVFDFSQRRKEYELEKQKKLEKERQE
QLQKEQEKAFFAQLQLDEETGEFLPIQPAQHIQSETSGSANYSQVAHIPKSDALYFDDCM
QLLAQTFPFVDDNEVSSATFQSLVPDIPGHIESPVFIATNQAQSPETSVAQVAPVDLDGM
QQDIEQVWEELLSIPELQCLNIENDKLVETTMVPSPEAKLTEVDNYHFYSSIPSMEKEVG
NCSPHFLNAFEDSFSSILSTEDPNQLTVNSLNSDATVNTDFGDEFYSAFIAEPSISNSMP
SPATLSHSLSELLNGPIDVSDLSLCKAFNQNHPESTAEFNDSDSGISLNTSPSVASPEHS
VESSSYGDTLLGLSDSEVEELDSAPGSVKQNGPKTPVHSSGDMVQPLSPSQGQSTHVHDA
QCENTPEKELPVSPGHRKTPFTKDKHSSRLEAHLTRDELRAKALHIPFPVEKIINLPVVD
FNEMMSKEQFNEAQLALIRDIRRRGKNKVAAQNCRKRKLENIVELEQDLDHLKDEKEKLL
KEKGENDKSLHLLKKQLSTLYLEVFSMLRDEDGKPYSPSEYSLQQTRDGNVFLVPKSKKP
DVKKN
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgatggacttggagctgccgccgccgggactcccgtcccagcaggacatggatttgatt
gacatactttggaggcaagatatagatcttggagtaagtcgagaagtatttgacttcagt
cagcgacggaaagagtatgagctggaaaaacagaaaaaacttgaaaaggaaagacaagaa
caactccaaaaggagcaagagaaagcctttttcgctcagttacaactagatgaagagaca
ggtgaatttctcccaattcagccagcccagcacatccagtcagaaaccagtggatctgcc
aactactcccaggttgcccacattcccaaatcagatgctttgtactttgatgactgcatg
cagcttttggcgcagacattcccgtttgtagatgacaatgaggtttcttcggctacgttt
cagtcacttgttcctgatattcccggtcacatcgagagcccagtcttcattgctactaat
caggctcagtcacctgaaacttctgttgctcaggtagcccctgttgatttagacggtatg
caacaggacattgagcaagtttgggaggagctattatccattcctgagttacagtgtctt
aatattgaaaatgacaagctggttgagactaccatggttccaagtccagaagccaaactg
acagaagttgacaattatcatttttactcatctataccctcaatggaaaaagaagtaggt
aactgtagtccacattttcttaatgcttttgaggattccttcagcagcatcctctccaca
gaagaccccaaccagttgacagtgaactcattaaattcagatgccacagtcaacacagat
tttggtgatgaattttattctgctttcatagctgagcccagtatcagcaacagcatgccc
tcacctgctactttaagccattcactctctgaacttctaaatgggcccattgatgtttct
gatctatcactttgcaaagctttcaaccaaaaccaccctgaaagcacagcagaattcaat
gattctgactccggcatttcactaaacacaagtcccagtgtggcatcaccagaacactca
gtggaatcttccagctatggagacacactacttggcctcagtgattctgaagtggaagag
ctagatagtgcccctggaagtgtcaaacagaatggtcctaaaacaccagtacattcttct
ggggatatggtacaacccttgtcaccatctcaggggcagagcactcacgtgcatgatgcc
caatgtgagaacacaccagagaaagaattgcctgtaagtcctggtcatcggaaaacccca
ttcacaaaagacaaacattcaagccgcttggaggctcatctcacaagagatgaacttagg
gcaaaagctctccatatcccattccctgtagaaaaaatcattaacctccctgttgttgac
ttcaacgaaatgatgtccaaagagcagttcaatgaagctcaacttgcattaattcgggat
atacgtaggaggggtaagaataaagtggctgctcagaattgcagaaaaagaaaactggaa
aatatagtagaactagagcaagatttagatcatttgaaagatgaaaaagaaaaattgctc
aaagaaaaaggagaaaatgacaaaagccttcacctactgaaaaaacaactcagcacctta
tatctcgaagttttcagcatgctacgtgatgaagatggaaaaccttattctcctagtgaa
tactccctgcagcaaacaagagatggcaatgttttccttgttcccaaaagtaagaagcca
gatgttaagaaaaactag

DBGET integrated database retrieval system