KEGG   Homo sapiens (human): 4780Help
Entry
4780              CDS       T01001                                 

Gene name
NFE2L2, HEBP1, IMDDHH, NRF2
Definition
(RefSeq) nuclear factor, erythroid 2 like 2
  KO
K05638  nuclear factor erythroid 2-related factor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
hsa05200  Pathways in cancer
hsa05225  Hepatocellular carcinoma
hsa05418  Fluid shear stress and atherosclerosis
Network
N00243  KEAP1-NRF2 signaling pathway
N00244  Mutation-inactivated KEAP1 to KEAP1-NRF2 signaling pathway
N00245  Mutation-activated NRF2 to KEAP1-NRF2 signaling pathway
Disease
H00048  Hepatocellular carcinoma
Drug target
Omaveloxolone: D10964
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    4780 (NFE2L2)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    4780 (NFE2L2)
   05225 Hepatocellular carcinoma
    4780 (NFE2L2)
  09165 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    4780 (NFE2L2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    4780 (NFE2L2)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    4780 (NFE2L2)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, NF-E2
    4780 (NFE2L2)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Nuclear respiratory factors
    4780 (NFE2L2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_Maf bZIP_1 bZIP_2 T3SS_basalb_I
Motif
Other DBs
NCBI-GeneID: 4780
NCBI-ProteinID: NP_006155
OMIM: 600492
HGNC: 7782
Ensembl: ENSG00000116044
Vega: OTTHUMG00000133620
Pharos: Q16236(Tchem)
UniProt: Q16236
Structure
PDB: 

Position
2q31.2
AA seq 605 aa AA seqDB search
MMDLELPPPGLPSQQDMDLIDILWRQDIDLGVSREVFDFSQRRKEYELEKQKKLEKERQE
QLQKEQEKAFFAQLQLDEETGEFLPIQPAQHIQSETSGSANYSQVAHIPKSDALYFDDCM
QLLAQTFPFVDDNEVSSATFQSLVPDIPGHIESPVFIATNQAQSPETSVAQVAPVDLDGM
QQDIEQVWEELLSIPELQCLNIENDKLVETTMVPSPEAKLTEVDNYHFYSSIPSMEKEVG
NCSPHFLNAFEDSFSSILSTEDPNQLTVNSLNSDATVNTDFGDEFYSAFIAEPSISNSMP
SPATLSHSLSELLNGPIDVSDLSLCKAFNQNHPESTAEFNDSDSGISLNTSPSVASPEHS
VESSSYGDTLLGLSDSEVEELDSAPGSVKQNGPKTPVHSSGDMVQPLSPSQGQSTHVHDA
QCENTPEKELPVSPGHRKTPFTKDKHSSRLEAHLTRDELRAKALHIPFPVEKIINLPVVD
FNEMMSKEQFNEAQLALIRDIRRRGKNKVAAQNCRKRKLENIVELEQDLDHLKDEKEKLL
KEKGENDKSLHLLKKQLSTLYLEVFSMLRDEDGKPYSPSEYSLQQTRDGNVFLVPKSKKP
DVKKN
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgatggacttggagctgccgccgccgggactcccgtcccagcaggacatggatttgatt
gacatactttggaggcaagatatagatcttggagtaagtcgagaagtatttgacttcagt
cagcgacggaaagagtatgagctggaaaaacagaaaaaacttgaaaaggaaagacaagaa
caactccaaaaggagcaagagaaagcctttttcgctcagttacaactagatgaagagaca
ggtgaatttctcccaattcagccagcccagcacatccagtcagaaaccagtggatctgcc
aactactcccaggttgcccacattcccaaatcagatgctttgtactttgatgactgcatg
cagcttttggcgcagacattcccgtttgtagatgacaatgaggtttcttcggctacgttt
cagtcacttgttcctgatattcccggtcacatcgagagcccagtcttcattgctactaat
caggctcagtcacctgaaacttctgttgctcaggtagcccctgttgatttagacggtatg
caacaggacattgagcaagtttgggaggagctattatccattcctgagttacagtgtctt
aatattgaaaatgacaagctggttgagactaccatggttccaagtccagaagccaaactg
acagaagttgacaattatcatttttactcatctataccctcaatggaaaaagaagtaggt
aactgtagtccacattttcttaatgcttttgaggattccttcagcagcatcctctccaca
gaagaccccaaccagttgacagtgaactcattaaattcagatgccacagtcaacacagat
tttggtgatgaattttattctgctttcatagctgagcccagtatcagcaacagcatgccc
tcacctgctactttaagccattcactctctgaacttctaaatgggcccattgatgtttct
gatctatcactttgcaaagctttcaaccaaaaccaccctgaaagcacagcagaattcaat
gattctgactccggcatttcactaaacacaagtcccagtgtggcatcaccagaacactca
gtggaatcttccagctatggagacacactacttggcctcagtgattctgaagtggaagag
ctagatagtgcccctggaagtgtcaaacagaatggtcctaaaacaccagtacattcttct
ggggatatggtacaacccttgtcaccatctcaggggcagagcactcacgtgcatgatgcc
caatgtgagaacacaccagagaaagaattgcctgtaagtcctggtcatcggaaaacccca
ttcacaaaagacaaacattcaagccgcttggaggctcatctcacaagagatgaacttagg
gcaaaagctctccatatcccattccctgtagaaaaaatcattaacctccctgttgttgac
ttcaacgaaatgatgtccaaagagcagttcaatgaagctcaacttgcattaattcgggat
atacgtaggaggggtaagaataaagtggctgctcagaattgcagaaaaagaaaactggaa
aatatagtagaactagagcaagatttagatcatttgaaagatgaaaaagaaaaattgctc
aaagaaaaaggagaaaatgacaaaagccttcacctactgaaaaaacaactcagcacctta
tatctcgaagttttcagcatgctacgtgatgaagatggaaaaccttattctcctagtgaa
tactccctgcagcaaacaagagatggcaatgttttccttgttcccaaaagtaagaagcca
gatgttaagaaaaactag

DBGET integrated database retrieval system