KEGG   Homo sapiens (human): 4781Help
Entry
4781              CDS       T01001                                 

Gene name
NFIB, CTF, HMGIC/NFIB, MACID, NF-I/B, NF1-B, NFI-B, NFI-RED, NFIB2, NFIB3
Definition
(RefSeq) nuclear factor I B
  KO
K09169  nuclear factor I/B
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    4781 (NFIB)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Other basic domains
   NF-1
    4781 (NFIB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTF_NFI NfI_DNAbd_pre-N MH1
Motif
Other DBs
NCBI-GeneID: 4781
NCBI-ProteinID: NP_005587
OMIM: 600728
HGNC: 7785
Ensembl: ENSG00000147862
Vega: OTTHUMG00000021027
Pharos: O00712(Tbio)
UniProt: O00712 Q5VW28
Position
9p23-p22.3
AA seq 420 aa AA seqDB search
MMYSPICLTQDEFHPFIEALLPHVRAIAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDE
LLSEKPEIKQKWASRLLAKLRKDIRQEYREDFVLTVTGKKHPCCVLSNPDQKGKIRRIDC
LRQADKVWRLDLVMVILFKGIPLESTDGERLMKSPHCTNPALCVQPHHITVSVKELDLFL
AYYVQEQDSGQSGSPSHNDPAKNPPGYLEDSFVKSGVFNVSELVRVSRTPITQGTGVNFP
IGEIPSQPYYHDMNSGVNLQRSLSSPPSSKRPKTISIDENMEPSPTGDFYPSPSSPAAGS
RTWHERDQDMSSPTTMKKPEKPLFSSASPQDSSPRLSTFPQHHHPGIPGVAHSVISTRTP
PPPSPLPFPTQAILPPAPSSYFSHPTIRYPPHLNPQDTLKNYVPSYDPSSPQTSQSWYLG
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgatgtattctcccatctgtctcactcaggatgaatttcacccattcatcgaggcactt
cttccacatgtccgtgcaattgcctatacttggttcaacctgcaggctcgaaaacgcaag
tactttaaaaagcatgagaagcgaatgtcaaaggatgaagaaagagcagtcaaagatgag
cttctcagtgaaaagcctgaaatcaaacagaagtgggcatccaggctccttgccaaactg
cgcaaagatattcgccaggagtatcgagaggactttgtgctcaccgtgactggcaagaag
cacccgtgctgtgtcttatccaatcccgaccagaagggtaagattaggagaatcgactgc
ctgcgacaggcagacaaagtctggcgtctggatctagtcatggtgatcctgttcaaaggc
atccccttggaaagtaccgatggagagcggctcatgaaatccccacattgcacaaaccca
gcactttgtgtccagccacatcatatcacagtatcagttaaggagcttgatttgtttttg
gcatactacgtgcaggagcaagattctggacaatcaggaagtccaagccacaatgatcct
gccaagaatcctccaggttaccttgaggatagttttgtaaaatctggagtcttcaatgta
tcagaacttgtaagagtatccagaacgcccataacccagggaactggagtcaacttccca
attggagaaatcccaagccaaccatactatcatgacatgaactcgggggtcaatcttcag
aggtctctgtcttctccaccaagcagcaaaagacccaaaactatatccatagatgaaaat
atggaaccaagtcctacaggagacttttacccctctccaagttcaccagctgctggaagt
cgaacatggcacgaaagagatcaagatatgtcttctccgactactatgaagaagcctgaa
aagccattgttcagctctgcatctccacaggattcttccccaagactgagcactttcccc
cagcaccaccatcccggaatacctggagttgcacacagtgtcatctcaactcgaactcca
cctccaccttcaccgttgccatttccaacacaagctatccttcctccagccccatcgagc
tacttttctcatccaacaatcagatatcctccccacctgaatcctcaggatactctgaag
aactatgtaccttcttatgacccatccagtccacaaaccagccagtcctggtacctgggc
tag

DBGET integrated database retrieval system