KEGG   Homo sapiens (human): 4792Help
Entry
4792              CDS       T01001                                 

Gene name
NFKBIA, IKBA, MAD-3, NFKBI
Definition
(RefSeq) NFKB inhibitor alpha
  KO
K04734  NF-kappa-B inhibitor alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04062  Chemokine signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04210  Apoptosis
hsa04380  Osteoclast differentiation
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa04662  B cell receptor signaling pathway
hsa04668  TNF signaling pathway
hsa04722  Neurotrophin signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa04926  Relaxin signaling pathway
hsa04931  Insulin resistance
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05131  Shigellosis
hsa05134  Legionellosis
hsa05140  Leishmaniasis
hsa05142  Chagas disease (American trypanosomiasis)
hsa05145  Toxoplasmosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05203  Viral carcinogenesis
hsa05215  Prostate cancer
hsa05220  Chronic myeloid leukemia
hsa05222  Small cell lung cancer
Module
hsa_M00686  Toll-like receptor signaling
Network
N00151  TNF-NFKB signaling pathway
N00171  KSHV vFLIP to NFKB signaling pathway
N00173  KSHV K15 to NFKB signaling pathway
N00174  KSHV vFLIP to TNF-NFKB signaling pathway
N00179  KSHV K1 to PI3K-NFKB signaling pathway
N00182  IGF-IGFR-PI3K-NFKB signaling pathway
N00390  EGF-EGFR-PI3K-NFKB signaling pathway
N00391  HCMV gB to EGFR-PI3K-NFKB signaling pathway
N00397  HCMV UL26 to TNF-NFKB signaling pathway
N00399  CCR2-GNB/G-PI3K-NFKB signaling pathway
N00400  HCMV US28 to GNB/G-PI3K-NFKB signaling pathway
N00435  TLR2/4-NFKB signaling pathway
N00441  HIV gp120 to TNF-NFKB signaling pathway
N00442  HIV Nef to TNF-NFKB signaling pathway
N00466  EBV BPLF1 to TLR2/4-NFKB signaling pathway
N00467  EBV BPLF1 to TLR2/4-NFKB signaling pathway
N00468  EBV BPLF1 to TLR2/4-NFKB signaling pathway
 » show all
Disease
H00007  Hodgkin lymphoma
H00095  Ectodermal dysplasia associated immunodeficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    4792 (NFKBIA)
   04668 TNF signaling pathway
    4792 (NFKBIA)
   04024 cAMP signaling pathway
    4792 (NFKBIA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    4792 (NFKBIA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    4792 (NFKBIA)
   04621 NOD-like receptor signaling pathway
    4792 (NFKBIA)
   04622 RIG-I-like receptor signaling pathway
    4792 (NFKBIA)
   04623 Cytosolic DNA-sensing pathway
    4792 (NFKBIA)
   04625 C-type lectin receptor signaling pathway
    4792 (NFKBIA)
   04660 T cell receptor signaling pathway
    4792 (NFKBIA)
   04658 Th1 and Th2 cell differentiation
    4792 (NFKBIA)
   04659 Th17 cell differentiation
    4792 (NFKBIA)
   04657 IL-17 signaling pathway
    4792 (NFKBIA)
   04662 B cell receptor signaling pathway
    4792 (NFKBIA)
   04062 Chemokine signaling pathway
    4792 (NFKBIA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    4792 (NFKBIA)
   04926 Relaxin signaling pathway
    4792 (NFKBIA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    4792 (NFKBIA)
  09158 Development
   04380 Osteoclast differentiation
    4792 (NFKBIA)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    4792 (NFKBIA)
   05203 Viral carcinogenesis
    4792 (NFKBIA)
  09162 Cancers: Specific types
   05220 Chronic myeloid leukemia
    4792 (NFKBIA)
   05215 Prostate cancer
    4792 (NFKBIA)
   05222 Small cell lung cancer
    4792 (NFKBIA)
  09167 Endocrine and metabolic diseases
   04931 Insulin resistance
    4792 (NFKBIA)
  09171 Infectious diseases: Bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    4792 (NFKBIA)
   05131 Shigellosis
    4792 (NFKBIA)
   05134 Legionellosis
    4792 (NFKBIA)
  09172 Infectious diseases: Viral
   05166 Human T-cell leukemia virus 1 infection
    4792 (NFKBIA)
   05170 Human immunodeficiency virus 1 infection
    4792 (NFKBIA)
   05162 Measles
    4792 (NFKBIA)
   05164 Influenza A
    4792 (NFKBIA)
   05161 Hepatitis B
    4792 (NFKBIA)
   05160 Hepatitis C
    4792 (NFKBIA)
   05168 Herpes simplex infection
    4792 (NFKBIA)
   05163 Human cytomegalovirus infection
    4792 (NFKBIA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    4792 (NFKBIA)
   05169 Epstein-Barr virus infection
    4792 (NFKBIA)
  09174 Infectious diseases: Parasitic
   05145 Toxoplasmosis
    4792 (NFKBIA)
   05140 Leishmaniasis
    4792 (NFKBIA)
   05142 Chagas disease (American trypanosomiasis)
    4792 (NFKBIA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    4792 (NFKBIA)
   04131 Membrane trafficking [BR:hsa04131]
    4792 (NFKBIA)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    4792 (NFKBIA)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    4792 (NFKBIA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank Ank_3 Ank_5 Ank_4
Motif
Other DBs
NCBI-GeneID: 4792
NCBI-ProteinID: NP_065390
OMIM: 164008
HGNC: 7797
Ensembl: ENSG00000100906
Vega: OTTHUMG00000140220
Pharos: P25963(Tchem)
UniProt: P25963
Structure
PDB: 

Position
14q13.2
AA seq 317 aa AA seqDB search
MFQAAERPQEWAMEGPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELQEIRLEPQEVP
RGSEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVI
TNQPEIAEALLGAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQSCTTPHLHSILKATN
YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG
ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEFTE
DELPYDDCVFGGQRLTL
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgttccaggcggccgagcgcccccaggagtgggccatggagggcccccgcgacgggctg
aagaaggagcggctactggacgaccgccacgacagcggcctggactccatgaaagacgag
gagtacgagcagatggtcaaggagctgcaggagatccgcctcgagccgcaggaggtgccg
cgcggctcggagccctggaagcagcagctcaccgaggacggggactcgttcctgcacttg
gccatcatccatgaagaaaaggcactgaccatggaagtgatccgccaggtgaagggagac
ctggccttcctcaacttccagaacaacctgcagcagactccactccacttggctgtgatc
accaaccagccagaaattgctgaggcacttctgggagctggctgtgatcctgagctccga
gactttcgaggaaatacccccctacaccttgcctgtgagcagggctgcctggccagcgtg
ggagtcctgactcagtcctgcaccaccccgcacctccactccatcctgaaggctaccaac
tacaatggccacacgtgtctacacttagcctctatccatggctacctgggcatcgtggag
cttttggtgtccttgggtgctgatgtcaatgctcaggagccctgtaatggccggactgcc
cttcacctcgcagtggacctgcaaaatcctgacctggtgtcactcctgttgaagtgtggg
gctgatgtcaacagagttacctaccagggctattctccctaccagctcacctggggccgc
ccaagcacccggatacagcagcagctgggccagctgacactagaaaaccttcagatgctg
ccagagagtgaggatgaggagagctatgacacagagtcagagttcacggagttcacagag
gacgagctgccctatgatgactgtgtgtttggaggccagcgtctgacgttatga

DBGET integrated database retrieval system