KEGG   Homo sapiens (human): 4800Help
Entry
4800              CDS       T01001                                 

Gene name
NFYA, CBF-A, CBF-B, HAP2, NF-YA
Definition
(RefSeq) nuclear transcription factor Y subunit alpha
  KO
K08064  nuclear transcription factor Y, alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04612  Antigen processing and presentation
hsa05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    4800 (NFYA)
 09160 Human Diseases
  09171 Infectious diseases: Bacterial
   05152 Tuberculosis
    4800 (NFYA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    4800 (NFYA)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   Heteromeric CCAAT factors
    4800 (NFYA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CBFB_NFYA
Motif
Other DBs
NCBI-GeneID: 4800
NCBI-ProteinID: NP_002496
OMIM: 189903
HGNC: 7804
Ensembl: ENSG00000001167
Vega: OTTHUMG00000014669
Pharos: P23511(Tbio)
UniProt: P23511
Structure
PDB: 

Position
6p21.1
AA seq 347 aa AA seqDB search
MEQYTANSNSSTEQIVVQAGQIQQQQQGGVTAVQLQTEAQVASASGQQVQTLQVVQGQPL
MVQVSGGQLITSTGQPIMVQAVPGGQGQTIMQVPVSGTQGLQQIQLVPPGQIQIQGGQAV
QVQGQQGQTQQIIIQQPQTAVTAGQTQTQQQIAVQGQQVAQTAEGQTIVYQPVNADGTIL
QQVTVPVSGMITIPAASLAGAQIVQTGANTNTTSSGQGTVTVTLPVAGNVVNSGGMVMMV
PGAGSVPAIQRIPLPGAEMLEEEPLYVNAKQYHRILKRRQARAKLEAEGKIPKERRKYLH
ESRHRHAMARKRGEGGRFFSPKEKDSPHMQDPNQADEEAMTQIIRVS
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggagcagtatacagcaaacagcaatagttcgacagagcagattgttgtccaggcagga
cagattcagcagcagcagcagggtggtgtcactgctgtgcagttgcagactgaggcccag
gtggcatccgcctcaggccagcaagtccagaccctccaggtagtccaagggcagccatta
atggtgcaggtcagtggaggccagctaatcacatcaactggccaacccatcatggtccag
gctgtccctggtggacaaggtcaaaccatcatgcaagtacctgtttctggaacacagggt
ttgcagcaaatacagttggtcccacctggacagatccagatccagggtggacaggctgtg
caggtgcagggccagcagggccagacccagcagatcatcatccagcagccccagacggct
gtcactgctggccagactcagacacagcagcagattgctgtccagggacagcaagtggca
cagactgctgaagggcagaccatcgtctatcaaccagttaatgcagatggcaccattctc
cagcaagttacagtccctgtttcaggcatgatcactatcccagcagccagtttggcagga
gcacagattgttcaaacaggagccaataccaacacaaccagcagtgggcaagggactgtc
actgtgacactaccagtggcaggcaatgtggtcaattcaggagggatggtcatgatggtt
cctggggctggctctgtgcctgctatccaaagaatccctctacctggagcagagatgctt
gaagaagagcctctctacgtgaatgccaaacaataccaccgtattcttaagaggaggcaa
gcccgagctaaactagaggcagaagggaaaattccaaaggagagaaggaaatacctgcat
gagtctcggcaccgtcatgccatggcacggaagcgtggtgaaggtggacgatttttctct
ccaaaggaaaaggatagtccccatatgcaggatccaaaccaagccgatgaagaagcaatg
acacagatcatccgagtgtcctaa

DBGET integrated database retrieval system