KEGG   Homo sapiens (human): 4802Help
Entry
4802              CDS       T01001                                 

Gene name
NFYC, CBF-C, CBFC, H1TF2A, HAP5, HSM, NF-YC
Definition
(RefSeq) nuclear transcription factor Y subunit gamma
  KO
K08066  nuclear transcription factor Y, gamma
Organism
hsa  Homo sapiens (human)
Pathway
hsa04612  Antigen processing and presentation
hsa05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04612 Antigen processing and presentation
    4802 (NFYC)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    4802 (NFYC)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   Heteromeric CCAAT factors
    4802 (NFYC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CBFD_NFYB_HMF Histone E1-E2_ATPase CENP-X
Motif
Other DBs
NCBI-GeneID: 4802
NCBI-ProteinID: NP_001295043
OMIM: 605344
HGNC: 7806
Ensembl: ENSG00000066136
Vega: OTTHUMG00000007729
Pharos: Q13952(Tbio)
UniProt: Q13952
Structure
PDB: 

Position
1p34.2
AA seq 458 aa AA seqDB search
MSTEGGFGGTSSSDAQQSLQSFWPRVMEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKM
ISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAITKFDQFDFLIDIVPR
DELKPPKRQEEVRQSVTPAEPVQYYFTLAQQPTAVQVQGQQQGQQTTSSTTTIQPGQIII
AQPQQGQTTPVTMQVGEGQQVQIVQAQPQGQAQQAQSGTGQTMQVMQQIITNTGEIQQIP
VQLNAGQLQYIRLAQPVSGTQVVQGQIQTLATNAQQGQRNASQGKPRRCLKETLQITQTE
VQQGQQQFSQFTDGQRNSVQQARVSELTGEAEPREVKATGNSTPCTSSLPTTHPPSHRAG
ASCVCCSQPQQSSTSPPPSDALQWVVVEVSGTPNQLETHRELHAPLPGMTSLSPLHPSQQ
LYQIQQVTMPAGQDLAQPMFIQSANQPSDGQAPQVTGD
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgtccacagaaggaggatttggtggtactagcagcagtgatgcccagcaaagcctacag
tcgttctggcctcgggtcatggaagaaatccggaatttaacagtgaaagacttccgagtg
caggaactcccactggctcgtattaagaagattatgaaactggatgaagatgtgaagatg
atcagtgcagaagcgcctgtactctttgccaaggcagcccagatttttatcacagagttg
actcttcgagcctggattcacacagaagataacaagcgccggactctacagagaaatgat
atcgccatggcaattacaaaatttgatcagtttgattttctcatcgatattgttccaaga
gatgaactgaaacctccaaagcgtcaggaggaggtgcgccagtctgtaactcctgccgag
ccagtccagtactatttcacgctggctcagcaacccaccgctgtccaagtccagggccag
cagcaaggccagcagaccaccagctccacgaccaccatccagcctgggcagatcatcatc
gcacagcctcagcagggccagaccacacctgtgacaatgcaggttggagaaggtcagcag
gtgcagattgtccaggctcagccacagggtcaagcccaacaggcccagagtggcactgga
cagaccatgcaggtgatgcagcagatcatcactaacacaggagagatccagcagatcccg
gtgcagctgaatgccggccagctgcagtatatccgcttagcccagcctgtatcaggcact
caagttgtgcagggacagatccagacacttgccaccaatgctcaacaggggcaaagaaat
gcaagtcaggggaagcctcgaaggtgcctgaaagaaaccttacagattacacagacagag
gtccagcaaggacagcagcagttcagccagttcacagatggacagaggaacagcgtgcag
caagctcgagtctctgagctaacgggagaggcagagcccagagaagtgaaagccacagga
aattcaactccctgcacctcttccctgcccaccacacaccccccctcacaccgggctggt
gcctcctgtgtctgctgctcccaaccccagcagagctccacttcccctcctccttctgac
gccttgcagtgggtggtggttgaggtatctgggacccccaaccagctcgagacccatagg
gagctgcatgcccctctcccagggatgacctcactctctcctctccacccctcgcagcag
ctctaccagatccagcaagtcaccatgcctgcgggccaggacctcgcccagcccatgttc
atccagtcagccaaccagccctccgacgggcaggccccccaggtgaccggcgactga

DBGET integrated database retrieval system