KEGG   Homo sapiens (human): 4803Help
Entry
4803              CDS       T01001                                 

Gene name
NGF, Beta-NGF, HSAN5, NGFB
Definition
(RefSeq) nerve growth factor
  KO
K02582  nerve growth factor, beta
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04210  Apoptosis
hsa04722  Neurotrophin signaling pathway
hsa04750  Inflammatory mediator regulation of TRP channels
Disease
H00265  Hereditary sensory and autonomic neuropathy (HSAN)
Drug target
Fulranumab: D09907
Tanezumab: D09387
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    4803 (NGF)
   04015 Rap1 signaling pathway
    4803 (NGF)
   04010 MAPK signaling pathway
    4803 (NGF)
   04151 PI3K-Akt signaling pathway
    4803 (NGF)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    4803 (NGF)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    4803 (NGF)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    4803 (NGF)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    4803 (NGF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    4803 (NGF)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    4803 (NGF)
Chaperones and folding catalysts [BR:hsa03110]
 Intramolecular chaperones
  Others
   4803 (NGF)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   4803 (NGF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NGF Spaetzle
Motif
Other DBs
NCBI-GeneID: 4803
NCBI-ProteinID: NP_002497
OMIM: 162030
HGNC: 7808
Ensembl: ENSG00000134259
Vega: OTTHUMG00000011880
Pharos: P01138(Tchem)
UniProt: P01138
Structure
PDB: 

Position
1p13.2
AA seq 241 aa AA seqDB search
MSMLFYTLITAFLIGIQAEPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIA
ARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSK
RSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCR
DPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRR
A
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgtccatgttgttctacactctgatcacagcttttctgatcggcatacaggcggaacca
cactcagagagcaatgtccctgcaggacacaccatcccccaagcccactggactaaactt
cagcattcccttgacactgcccttcgcagagcccgcagcgccccggcagcggcgatagct
gcacgcgtggcggggcagacccgcaacattactgtggaccccaggctgtttaaaaagcgg
cgactccgttcaccccgtgtgctgtttagcacccagcctccccgtgaagctgcagacact
caggatctggacttcgaggtcggtggtgctgcccccttcaacaggactcacaggagcaag
cggtcatcatcccatcccatcttccacaggggcgaattctcggtgtgtgacagtgtcagc
gtgtgggttggggataagaccaccgccacagacatcaagggcaaggaggtgatggtgttg
ggagaggtgaacattaacaacagtgtattcaaacagtacttttttgagaccaagtgccgg
gacccaaatcccgttgacagcgggtgccggggcattgactcaaagcactggaactcatat
tgtaccacgactcacacctttgtcaaggcgctgaccatggatggcaagcaggctgcctgg
cggtttatccggatagatacggcctgtgtgtgtgtgctcagcaggaaggctgtgagaaga
gcctga

DBGET integrated database retrieval system