KEGG   Homo sapiens (human): 4807
Entry
4807              CDS       T01001                                 
Symbol
NHLH1, HEN1, NSCL, NSCL1, bHLHa35
Name
(RefSeq) nescient helix-loop-helix 1
  KO
K09075  nescient helix-loop-helix protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    4807 (NHLH1)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Tal/Twist/Atonal/Hen, HEN
    4807 (NHLH1)
SSDB
Motif
Pfam: HLH
Other DBs
NCBI-GeneID: 4807
NCBI-ProteinID: NP_005589
OMIM: 162360
HGNC: 7817
Ensembl: ENSG00000171786
UniProt: Q02575 Q5T203
Position
1:160367071..160372846
AA seq 133 aa
MMLNSDTMELDLPPTHSETESGFSDCGGGAGPDGAGPGGPGGGQARGPEPGEPGRKDLQH
LSREERRRRRRATAKYRTAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLA
ICYISYLNHVLDV
NT seq 402 nt   +upstreamnt  +downstreamnt
atgatgctcaactcagacaccatggagctggacctgccgcccacccactcagagactgag
tcgggcttcagtgactgtgggggcggggcgggccctgatggtgccgggcctgggggtccg
ggagggggccaggcccgaggcccagagccgggagagcctggccggaaagacctgcagcat
ctgagccgcgaggagcgccggcgccggcgccgcgccacagccaagtaccgcacggcccac
gccacgcgagaacgcatccgcgtggaagccttcaacctggccttcgccgagctgcgcaag
ctgctgcctacgctgccccccgacaagaagctctccaagattgagattctgcgcctggcc
atctgctatatctcctacctgaaccacgtgctggacgtctga

DBGET integrated database retrieval system