KEGG   Homo sapiens (human): 4811
Entry
4811              CDS       T01001                                 
Symbol
NID1, NID
Name
(RefSeq) nidogen 1
  KO
K06826  nidogen (entactin)
Organism
hsa  Homo sapiens (human)
Pathway
hsa04820  Cytoskeleton in muscle cells
Network
nt06539  Cytoskeleton in muscle cells
  Element
N01814  Extracellular matrix - Basal lamina
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09142 Cell motility
   04820 Cytoskeleton in muscle cells
    4811 (NID1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    4811 (NID1)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 EGF-like domain-containing proteins
  cEGF domain-containing proteins
   4811 (NID1)
SSDB
Motif
Pfam: G2F NIDO EGF_3 Ldl_recept_b Thyroglobulin_1 cEGF EGF FXa_inhibition EGF_CA EGF_MSP1_1 SGL Plasmod_Pvs28 hEGF
Other DBs
NCBI-GeneID: 4811
NCBI-ProteinID: NP_002499
OMIM: 131390
HGNC: 7821
Ensembl: ENSG00000116962
UniProt: P14543
Position
1:complement(235975830..236065090)
AA seq 1247 aa
MLASSSRIRAAWTRALLLPLLLAGPVGCLSRQELFPFGPGQGDLELEDGDDFVSPALELS
GALRFYDRSDIDAVYVTTNGIIATSEPPAKESHPGLFPPTFGAVAPFLADLDTTDGLGKV
YYREDLSPSITQRAAECVHRGFPEISFQPSSAVVVTWESVAPYQGPSRDPDQKGKRNTFQ
AVLASSDSSSYAIFLYPEDGLQFHTTFSKKENNQVPAVVAFSQGSVGFLWKSNGAYNIFA
NDRESVENLAKSSNSGQQGVWVFEIGSPATTNGVVPADVILGTEDGAEYDDEDEDYDLAT
TRLGLEDVGTTPFSYKALRRGGADTYSVPSVLSPRRAATERPLGPPTERTRSFQLAVETF
HQQHPQVIDVDEVEETGVVFSYNTDSRQTCANNRHQCSVHAECRDYATGFCCSCVAGYTG
NGRQCVAEGSPQRVNGKVKGRIFVGSSQVPIVFENTDLHSYVVMNHGRSYTAISTIPETV
GYSLLPLAPVGGIIGWMFAVEQDGFKNGFSITGGEFTRQAEVTFVGHPGNLVIKQRFSGI
DEHGHLTIDTELEGRVPQIPFGSSVHIEPYTELYHYSTSVITSSSTREYTVTEPERDGAS
PSRIYTYQWRQTITFQECVHDDSRPALPSTQQLSVDSVFVLYNQEEKILRYALSNSIGPV
REGSPDALQNPCYIGTHGCDTNAACRPGPRTQFTCECSIGFRGDGRTCYDIDECSEQPSV
CGSHTICNNHPGTFRCECVEGYQFSDEGTCVAVVDQRPINYCETGLHNCDIPQRAQCIYT
GGSSYTCSCLPGFSGDGQACQDVDECQPSRCHPDAFCYNTPGSFTCQCKPGYQGDGFRCV
PGEVEKTRCQHEREHILGAAGATDPQRPIPPGLFVPECDAHGHYAPTQCHGSTGYCWCVD
RDGREVEGTRTRPGMTPPCLSTVAPPIHQGPAVPTAVIPLPPGTHLLFAQTGKIERLPLE
GNTMRKTEAKAFLHVPAKVIIGLAFDCVDKMVYWTDITEPSIGRASLHGGEPTTIIRQDL
GSPEGIAVDHLGRNIFWTDSNLDRIEVAKLDGTQRRVLFETDLVNPRGIVTDSVRGNLYW
TDWNRDNPKIETSYMDGTNRRILVQDDLGLPNGLTFDAFSSQLCWVDAGTNRAECLNPSQ
PSRRKALEGLQYPFAVTSYGKNLYFTDWKMNSVVALDLAISKETDAFQPHKQTRLYGITT
ALSQCPQGHNYCSVNNGGCTHLCLATPGSRTCRCPDNTLGVDCIEQK
NT seq 3744 nt   +upstreamnt  +downstreamnt
atgttggcctcgagcagccggatccgggctgcgtggacgcgggcgctgctgctgccgctg
ctgctggcggggcctgtgggctgcctgagccgccaggagctctttcccttcggccccgga
cagggggacctggagctggaggacggggatgacttcgtctctcctgccctggagctgagt
ggggcgctccgcttctacgacagatccgacatcgacgcagtctacgtcaccacaaatggc
atcattgctacgagtgaacccccggccaaagaatcccatcccgggctcttcccaccaaca
ttcggtgcagtcgcccctttcctggcggacttggacacgaccgatggcctggggaaggtt
tattatcgagaagacttatccccctccatcactcagcgagcagcagagtgtgtccacaga
gggttcccggagatctctttccagcctagtagcgcggtggttgtcacttgggaatccgtg
gccccctaccaagggcccagcagggacccagaccagaaaggcaagagaaacacgttccag
gctgttctagcctcctctgattccagctcctatgccattttcctttatcctgaggatggt
ctgcagttccatacgacattctcaaagaaggaaaacaaccaagttcctgccgtggttgca
ttcagtcaaggttcagtgggattcttatggaagagcaacggagcttataacatatttgct
aatgacagggaatcagttgaaaatttggccaagagtagtaactctgggcagcagggtgtc
tgggtgtttgagattgggagtccagccaccaccaatggcgtggtgcctgcagacgtgatc
ctcggaactgaagatggggcagagtatgatgatgaggatgaagattatgacctggcgacc
actcgtctgggcctggaggatgtgggcaccacgcccttctcctacaaggctctgagaagg
ggaggtgctgacacatacagtgtgcccagcgtcctctccccgcgccgggcagctaccgaa
aggccccttggacctcccacagagagaaccaggtctttccagttggcagtggagactttt
caccagcagcaccctcaggtcatagatgtggatgaagttgaggaaacaggagttgttttc
agctataacacggattcccgccagacgtgtgctaacaacagacaccagtgctcggtgcac
gcagagtgcagggactacgccacgggcttctgctgcagctgtgtcgctggctatacgggc
aatggcaggcaatgtgttgcagaaggttccccccagcgagtcaatggcaaggtgaaagga
aggatctttgtggggagcagccaggtccccattgtctttgagaacactgacctccactct
tacgtagtaatgaaccacgggcgctcctacacagccatcagcaccattcccgagaccgtt
ggatattctctgcttccactggccccagttggaggcatcattggatggatgtttgcagtg
gagcaggacggattcaagaatgggttcagcatcaccgggggtgagttcactcgccaggct
gaggtgaccttcgtggggcacccgggcaatctggtcattaagcagcggttcagcggcatc
gatgagcatgggcacctgaccatcgacacggagctggagggccgcgtgccgcagattccg
ttcggctcctccgtgcacattgagccctacacggagctgtaccactactccacctcagtg
atcacttcctcctccacccgggagtacacggtgactgagcccgagcgagatggggcatct
ccttcacgcatctacacttaccagtggcgccagaccatcaccttccaggaatgcgtccac
gatgactcccggccagccctgcccagcacccagcagctctcggtggacagcgtgttcgtc
ctgtacaaccaggaggagaagatcttgcgctatgctctcagcaactccattgggcctgtg
agggaaggctcccctgatgctcttcagaatccctgctacatcggcactcatgggtgtgac
accaacgcggcctgtcgccctggtcccaggacacagttcacctgcgagtgctccatcggc
ttccgaggagacgggcgaacctgctatgatattgatgaatgttcagaacaaccctcagtg
tgtgggagccacacaatctgcaataatcacccaggaaccttccgctgcgagtgtgtggag
ggctaccagttttcagatgagggaacgtgtgtggctgtcgtggaccagcgccccatcaac
tactgtgaaactggccttcataactgcgacataccccagcgggcccagtgtatctacaca
ggaggctcctcctacacctgttcctgcttgccaggcttttctggggatggccaagcctgc
caagatgtagatgaatgccagccaagccgatgtcaccctgacgccttctgctacaacact
ccaggctctttcacgtgccagtgcaaacctggttatcagggagacggcttccgttgcgtg
cccggagaggtggagaaaacccggtgccagcacgagcgagaacacattctcggggcagcg
ggggcgacagacccacagcgacccattcctccggggctgttcgttcctgagtgcgatgcg
cacgggcactacgcgcccacccagtgccacggcagcaccggctactgctggtgcgtggat
cgcgacggccgcgaggtggagggcaccaggaccaggcccgggatgacgcccccgtgtctg
agtacagtggctcccccgattcaccaaggacctgcggtgcctaccgccgtgatccccttg
cctcctgggacccatttactctttgcccagactgggaagattgagcgcctgcccctggag
ggaaataccatgaggaagacagaagcaaaggcgttccttcatgtcccggctaaagtcatc
attggactggcctttgactgcgtggacaagatggtttactggacggacatcactgagcct
tccattgggagagctagtctacatggtggagagccaaccaccatcattagacaagatctt
ggaagtccagaaggtatcgctgttgatcaccttggccgcaacatcttctggacagactct
aacctggatcgaatagaagtggcgaagctggacggcacgcagcgccgggtgctctttgag
actgacttggtgaatcccagaggcattgtaacggattccgtgagagggaacctttactgg
acagactggaacagagataaccccaagattgaaacttcctacatggacggcacgaaccgg
aggatccttgtgcaggatgacctgggcttgcccaatggactgaccttcgatgcgttctca
tctcagctctgctgggtggatgcaggcaccaatcgggcggaatgcctgaaccccagtcag
cccagcagacgcaaggctctcgaagggctccagtatccttttgctgtgacgagctacggg
aagaatctgtatttcacagactggaagatgaattccgtggttgctctcgatcttgcaatt
tccaaggagacggatgctttccaaccccacaagcagacccggctgtatggcatcaccacg
gccctgtctcagtgtccgcaaggccataactactgctcagtgaacaatggcggctgcacc
cacctatgcttggccaccccagggagcaggacctgccgttgccctgacaacaccttggga
gttgactgtatcgaacagaaatga

DBGET integrated database retrieval system