KEGG   Homo sapiens (human): 4811Help
Entry
4811              CDS       T01001                                 

Gene name
NID1, NID
Definition
(RefSeq) nidogen 1
  KO
K06826  nidogen (entactin)
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    4811 (NID1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G2F Ldl_recept_b EGF_3 NIDO Thyroglobulin_1 cEGF EGF FXa_inhibition EGF_CA SGL EGF_MSP1_1 hEGF
Motif
Other DBs
NCBI-GeneID: 4811
NCBI-ProteinID: NP_002499
OMIM: 131390
HGNC: 7821
Ensembl: ENSG00000116962
Vega: OTTHUMG00000040071
Pharos: P14543(Tbio)
UniProt: P14543
Position
1q42.3
AA seq 1247 aa AA seqDB search
MLASSSRIRAAWTRALLLPLLLAGPVGCLSRQELFPFGPGQGDLELEDGDDFVSPALELS
GALRFYDRSDIDAVYVTTNGIIATSEPPAKESHPGLFPPTFGAVAPFLADLDTTDGLGKV
YYREDLSPSITQRAAECVHRGFPEISFQPSSAVVVTWESVAPYQGPSRDPDQKGKRNTFQ
AVLASSDSSSYAIFLYPEDGLQFHTTFSKKENNQVPAVVAFSQGSVGFLWKSNGAYNIFA
NDRESVENLAKSSNSGQQGVWVFEIGSPATTNGVVPADVILGTEDGAEYDDEDEDYDLAT
TRLGLEDVGTTPFSYKALRRGGADTYSVPSVLSPRRAATERPLGPPTERTRSFQLAVETF
HQQHPQVIDVDEVEETGVVFSYNTDSRQTCANNRHQCSVHAECRDYATGFCCSCVAGYTG
NGRQCVAEGSPQRVNGKVKGRIFVGSSQVPIVFENTDLHSYVVMNHGRSYTAISTIPETV
GYSLLPLAPVGGIIGWMFAVEQDGFKNGFSITGGEFTRQAEVTFVGHPGNLVIKQRFSGI
DEHGHLTIDTELEGRVPQIPFGSSVHIEPYTELYHYSTSVITSSSTREYTVTEPERDGAS
PSRIYTYQWRQTITFQECVHDDSRPALPSTQQLSVDSVFVLYNQEEKILRYALSNSIGPV
REGSPDALQNPCYIGTHGCDTNAACRPGPRTQFTCECSIGFRGDGRTCYDIDECSEQPSV
CGSHTICNNHPGTFRCECVEGYQFSDEGTCVAVVDQRPINYCETGLHNCDIPQRAQCIYT
GGSSYTCSCLPGFSGDGQACQDVDECQPSRCHPDAFCYNTPGSFTCQCKPGYQGDGFRCV
PGEVEKTRCQHEREHILGAAGATDPQRPIPPGLFVPECDAHGHYAPTQCHGSTGYCWCVD
RDGREVEGTRTRPGMTPPCLSTVAPPIHQGPAVPTAVIPLPPGTHLLFAQTGKIERLPLE
GNTMRKTEAKAFLHVPAKVIIGLAFDCVDKMVYWTDITEPSIGRASLHGGEPTTIIRQDL
GSPEGIAVDHLGRNIFWTDSNLDRIEVAKLDGTQRRVLFETDLVNPRGIVTDSVRGNLYW
TDWNRDNPKIETSYMDGTNRRILVQDDLGLPNGLTFDAFSSQLCWVDAGTNRAECLNPSQ
PSRRKALEGLQYPFAVTSYGKNLYFTDWKMNSVVALDLAISKETDAFQPHKQTRLYGITT
ALSQCPQGHNYCSVNNGGCTHLCLATPGSRTCRCPDNTLGVDCIEQK
NT seq 3744 nt NT seq  +upstreamnt  +downstreamnt
atgttggcctcgagcagccggatccgggctgcgtggacgcgggcgctgctgctgccgctg
ctgctggcggggcctgtgggctgcctgagccgccaggagctctttcccttcggccccgga
cagggggacctggagctggaggacggggatgacttcgtctctcctgccctggagctgagt
ggggcgctccgcttctacgacagatccgacatcgacgcagtctacgtcaccacaaatggc
atcattgctacgagtgaacccccggccaaagaatcccatcccgggctcttcccaccaaca
ttcggtgcagtcgcccctttcctggcggacttggacacgaccgatggcctggggaaggtt
tattatcgagaagacttatccccctccatcactcagcgagcagcagagtgtgtccacaga
gggttcccggagatctctttccagcctagtagcgcggtggttgtcacttgggaatccgtg
gccccctaccaagggcccagcagggacccagaccagaaaggcaagagaaacacgttccag
gctgttctagcctcctctgattccagctcctatgccattttcctttatcctgaggatggt
ctgcagttccatacgacattctcaaagaaggaaaacaaccaagttcctgccgtggttgca
ttcagtcaaggttcagtgggattcttatggaagagcaacggagcttataacatatttgct
aatgacagggaatcagttgaaaatttggccaagagtagtaactctgggcagcagggtgtc
tgggtgtttgagattgggagtccagccaccaccaatggcgtggtgcctgcagacgtgatc
ctcggaactgaagatggggcagagtatgatgatgaggatgaagattatgacctggcgacc
actcgtctgggcctggaggatgtgggcaccacgcccttctcctacaaggctctgagaagg
ggaggtgctgacacatacagtgtgcccagcgtcctctccccgcgccgggcagctaccgaa
aggccccttggacctcccacagagagaaccaggtctttccagttggcagtggagactttt
caccagcagcaccctcaggtcatagatgtggatgaagttgaggaaacaggagttgttttc
agctataacacggattcccgccagacgtgtgctaacaacagacaccagtgctcggtgcac
gcagagtgcagggactacgccacgggcttctgctgcagctgtgtcgctggctatacgggc
aatggcaggcaatgtgttgcagaaggttccccccagcgagtcaatggcaaggtgaaagga
aggatctttgtggggagcagccaggtccccattgtctttgagaacactgacctccactct
tacgtagtaatgaaccacgggcgctcctacacagccatcagcaccattcccgagaccgtt
ggatattctctgcttccactggccccagttggaggcatcattggatggatgtttgcagtg
gagcaggacggattcaagaatgggttcagcatcaccgggggtgagttcactcgccaggct
gaggtgaccttcgtggggcacccgggcaatctggtcattaagcagcggttcagcggcatc
gatgagcatgggcacctgaccatcgacacggagctggagggccgcgtgccgcagattccg
ttcggctcctccgtgcacattgagccctacacggagctgtaccactactccacctcagtg
atcacttcctcctccacccgggagtacacggtgactgagcccgagcgagatggggcatct
ccttcacgcatctacacttaccagtggcgccagaccatcaccttccaggaatgcgtccac
gatgactcccggccagccctgcccagcacccagcagctctcggtggacagcgtgttcgtc
ctgtacaaccaggaggagaagatcttgcgctatgctctcagcaactccattgggcctgtg
agggaaggctcccctgatgctcttcagaatccctgctacatcggcactcatgggtgtgac
accaacgcggcctgtcgccctggtcccaggacacagttcacctgcgagtgctccatcggc
ttccgaggagacgggcgaacctgctatgatattgatgaatgttcagaacaaccctcagtg
tgtgggagccacacaatctgcaataatcacccaggaaccttccgctgcgagtgtgtggag
ggctaccagttttcagatgagggaacgtgtgtggctgtcgtggaccagcgccccatcaac
tactgtgaaactggccttcataactgcgacataccccagcgggcccagtgtatctacaca
ggaggctcctcctacacctgttcctgcttgccaggcttttctggggatggccaagcctgc
caagatgtagatgaatgccagccaagccgatgtcaccctgacgccttctgctacaacact
ccaggctctttcacgtgccagtgcaaacctggttatcagggagacggcttccgttgcgtg
cccggagaggtggagaaaacccggtgccagcacgagcgagaacacattctcggggcagcg
ggggcgacagacccacagcgacccattcctccggggctgttcgttcctgagtgcgatgcg
cacgggcactacgcgcccacccagtgccacggcagcaccggctactgctggtgcgtggat
cgcgacggccgcgaggtggagggcaccaggaccaggcccgggatgacgcccccgtgtctg
agtacagtggctcccccgattcaccaaggacctgcggtgcctaccgccgtgatccccttg
cctcctgggacccatttactctttgcccagactgggaagattgagcgcctgcccctggag
ggaaataccatgaggaagacagaagcaaaggcgttccttcatgtcccggctaaagtcatc
attggactggcctttgactgcgtggacaagatggtttactggacggacatcactgagcct
tccattgggagagctagtctacatggtggagagccaaccaccatcattagacaagatctt
ggaagtccagaaggtatcgctgttgatcaccttggccgcaacatcttctggacagactct
aacctggatcgaatagaagtggcgaagctggacggcacgcagcgccgggtgctctttgag
actgacttggtgaatcccagaggcattgtaacggattccgtgagagggaacctttactgg
acagactggaacagagataaccccaagattgaaacttcctacatggacggcacgaaccgg
aggatccttgtgcaggatgacctgggcttgcccaatggactgaccttcgatgcgttctca
tctcagctctgctgggtggatgcaggcaccaatcgggcggaatgcctgaaccccagtcag
cccagcagacgcaaggctctcgaagggctccagtatccttttgctgtgacgagctacggg
aagaatctgtatttcacagactggaagatgaattccgtggttgctctcgatcttgcaatt
tccaaggagacggatgctttccaaccccacaagcagacccggctgtatggcatcaccacg
gccctgtctcagtgtccgcaaggccataactactgctcagtgaacaatggcggctgcacc
cacctatgcttggccaccccagggagcaggacctgccgttgccctgacaacaccttggga
gttgactgtatcgaacagaaatga

DBGET integrated database retrieval system