KEGG   Homo sapiens (human): 482Help
Entry
482               CDS       T01001                                 

Gene name
ATP1B2, AMOG
Definition
(RefSeq) ATPase Na+/K+ transporting subunit beta 2
  KO
K01540  sodium/potassium-transporting ATPase subunit beta
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04260  Cardiac muscle contraction
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04911  Insulin secretion
hsa04918  Thyroid hormone synthesis
hsa04919  Thyroid hormone signaling pathway
hsa04925  Aldosterone synthesis and secretion
hsa04960  Aldosterone-regulated sodium reabsorption
hsa04961  Endocrine and other factor-regulated calcium reabsorption
hsa04964  Proximal tubule bicarbonate reclamation
hsa04970  Salivary secretion
hsa04971  Gastric acid secretion
hsa04972  Pancreatic secretion
hsa04973  Carbohydrate digestion and absorption
hsa04974  Protein digestion and absorption
hsa04976  Bile secretion
hsa04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    482 (ATP1B2)
   04022 cGMP - PKG signaling pathway
    482 (ATP1B2)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    482 (ATP1B2)
   04918 Thyroid hormone synthesis
    482 (ATP1B2)
   04919 Thyroid hormone signaling pathway
    482 (ATP1B2)
   04925 Aldosterone synthesis and secretion
    482 (ATP1B2)
  Circulatory system
   04260 Cardiac muscle contraction
    482 (ATP1B2)
   04261 Adrenergic signaling in cardiomyocytes
    482 (ATP1B2)
  Digestive system
   04970 Salivary secretion
    482 (ATP1B2)
   04971 Gastric acid secretion
    482 (ATP1B2)
   04972 Pancreatic secretion
    482 (ATP1B2)
   04976 Bile secretion
    482 (ATP1B2)
   04973 Carbohydrate digestion and absorption
    482 (ATP1B2)
   04974 Protein digestion and absorption
    482 (ATP1B2)
   04978 Mineral absorption
    482 (ATP1B2)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    482 (ATP1B2)
   04961 Endocrine and other factor-regulated calcium reabsorption
    482 (ATP1B2)
   04964 Proximal tubule bicarbonate reclamation
    482 (ATP1B2)
CD molecules [BR:hsa04090]
 Proteins
  482 (ATP1B2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Na_K-ATPase
Motif
Other DBs
NCBI-GeneID: 482
NCBI-ProteinID: NP_001669
OMIM: 182331
HGNC: 805
Ensembl: ENSG00000129244
Vega: OTTHUMG00000178018
Pharos: P14415(Tclin)
UniProt: P14415
Position
17p13.1
AA seq 290 aa AA seqDB search
MVIQKEKKSCGQVVEEWKEFVWNPRTHQFMGRTGTSWAFILLFYLVFYGFLTAMFTLTMW
VMLQTVSDHTPKYQDRLATPGLMIRPKTENLDVIVNVSDTESWDQHVQKLNKFLEPYNDS
IQAQKNDVCRPGRYYEQPDNGVLNYPKRACQFNRTQLGNCSGIGDSTHYGYSTGQPCVFI
KMNRVINFYAGANQSMNVTCAGKRDEDAENLGNFVMFPANGNIDLMYFPYYGKKFHVNYT
QPLVAVKFLNVTPNVEVNVECRINAANIATDDERDKFAGRVAFKLRINKT
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggtcatccagaaagagaagaagagctgcgggcaggtggttgaggagtggaaggagttc
gtgtggaacccgaggacgcaccagtttatgggccgcaccgggaccagctgggcctttatc
ctcctcttctacctcgttttttatgggttcctcaccgccatgttcaccctcaccatgtgg
gtgatgctgcagactgtctccgaccatacccccaagtaccaggaccgactggccacaccg
ggcttgatgattcgccccaagactgagaaccttgatgtcattgtcaatgtcagtgacact
gaaagctgggaccagcatgttcagaagctcaacaagttcttggagccttacaacgactct
atccaagcccaaaagaatgatgtctgccgccctggacgctattacgaacagccagataat
ggagtcctcaactaccccaaacgtgcctgccaattcaaccggacccagctgggcaactgc
tccggcattggggactccacccactatggttacagcactgggcagccctgtgtcttcatc
aagatgaaccgggtcatcaacttctatgcaggagcaaaccagagcatgaatgttacctgt
gctgggaagcgagatgaagatgctgagaatctcggcaacttcgtcatgttccccgccaac
ggcaacatcgacctcatgtacttcccctactatggcaaaaagttccacgtgaactacaca
cagcccctggtggctgtgaagttcctgaatgtgacccccaacgtggaggtgaatgtagaa
tgtcgcatcaacgccgccaacatcgccacagacgatgagcgagacaagttcgccggccgc
gtggccttcaaactccgcatcaacaaaacctga

DBGET integrated database retrieval system