KEGG   Homo sapiens (human): 4820Help
Entry
4820              CDS       T01001                                 

Gene name
NKTR, p104
Definition
(RefSeq) natural killer cell triggering receptor
  KO
K12740  NK-tumor recognition protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    4820 (NKTR)
Chaperones and folding catalysts [BR:hsa03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    4820 (NKTR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase SR-25
Motif
Other DBs
NCBI-GeneID: 4820
NCBI-ProteinID: NP_005376
OMIM: 161565
HGNC: 7833
Ensembl: ENSG00000114857
Vega: OTTHUMG00000133037
Pharos: P30414(Tdark)
UniProt: P30414 A0A024R2N6
Structure
PDB: 

Position
3p22.1
AA seq 1462 aa AA seqDB search
MGAQDRPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYK
GSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNG
SQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVLATKS
IKDVFEKKRKKPTHSEGSDSSSNSSSSSESSSESELEHERSRRRKHKRRPKVKRSKKRRK
EASSSEEPRNKHAMNPKGHSERSDTNEKRSVDSSAKREKPVVRPEEIPPVPENRFLLRRD
MPVVTAEPEPKIPDVAPIVSDQKPSVSKSGRKIKGRGTIRYHTPPRSRSCSESDDDDSSE
TPPHWKEEMQRLRAYRPPSGEKWSKGDKLSDPCSSRWDERSLSQRSRSWSYNGYYSDLST
ARHSGHHKKRRKEKKVKHKKKGKKQKHCRRHKQTKKRRILIPSDIESSKSSTRRMKSSCD
RERSSRSSSLSSHHSSKRDWSKSDKDVQSSLTHSSRDSYRSKSHSQSYSRGSSRSRTASK
SSSHSRSRSKSRSSSKSGHRKRASKSPRKTASQLSENKPVKTEPLRATMAQNENVVVQPV
VAENIPVIPLSDSPPPSRWKPGQKPWKPSYERIQEMKAKTTHLLPIQSTYSLANIKETGS
SSSYHKREKNSESDQSTYSKYSDRSSESSPRSRSRSSRSRSYSRSYTRSRSLASSHSRSR
SPSSRSHSRNKYSDHSQCSRSSSYTSISSDDGRRAKRRLRSSGKKNSVSHKKHSSSSEKT
LHSKYVKGRDRSSCVRKYSESRSSLDYSSDSEQSSVQATQSAQEKEKQGQMERTHNKQEK
NRGEEKSKSERECPHSKKRTLKENLSDHLRNGSKPKRKNYAGSKWDSESNSERDVTKNSK
NDSHPSSDKEEGEATSDSESEVSEIHIKVKPTTKSSTNTSLPDDNGAWKSSKQRTSTSDS
EGSCSNSENNRGKPQKHKHGSKENLKREHTKKVKEKLKGKKDKKHKAPKRKQAFHWQPPL
EFGEEEEEEIDDKQVTQESKEKKVSENNETIKDNILKTEKSSEEDLSGKHDTVTVSSDLD
QFTKDDSKLSISPTALNTEENVACLQNIQHVEESVPNGVEDVLQTDDNMEICTPDRSSPA
KVEETSPLGNARLDTPDINIVLKQDMATEHPQAEVVKQESSMSESKVLGEVGKQDSSSAS
LASAGESTGKKEVAEKSQINLIDKKWKPLQGVGNLAAPNAATSSAVEVKVLTTVPEMKPQ
GLRIEIKSKNKVRPGSLFDEVRKTARLNRRPRNQESSSDEQTPSRDDDSQSRSPSRSRSK
SETKSRHRTRSVSYSHSRSRSRSSTSSYRSRSYSRSRSRGWYSRGRTRSRSSSYRSYKSH
RTSSRSRSRSSSYDPHSRSRSYTYDSYYSRSRSRSRSQRSDSYHRGRSYNRRSRSCRSYG
SDSESDRSYSHHRSPSESSRYS
NT seq 4389 nt NT seq  +upstreamnt  +downstreamnt
atgggggcgcaggaccggccgcagtgccacttcgacatcgagatcaaccgggagccggtt
ggtcgcattatgtttcagctcttctcagacatatgtccaaaaacatgcaaaaacttcctt
tgcttgtgctcaggagagaaaggccttgggaaaacaactgggaagaagttatgttataaa
ggttctacgttccatcgtgtggttaaaaactttatgattcagggtggggacttcagtgaa
ggtaatggaaaaggtggagaatcaatttatggtggatattttaaagatgaaaactttatt
ctcaaacatgacagagcgttccttttatcaatggcaaatcgagggaaacataccaatggt
tcccagtttttcattaccacaaagcctgctccacacctggatggggtgcatgtagtcttt
ggactggttatttctggttttgaagtaatcgaacaaattgaaaatctgaagaccgatgct
gcaagcagaccatatgcagatgtgcgagttattgactgtggagtacttgccacaaaatca
ataaaagatgtttttgagaaaaaaaggaagaaaccaactcattcagaaggctcggattcc
tcttccaattcctcctcttcttcagaatcatcttcagaaagtgaacttgaacatgagaga
agcagaaggaggaaacataagaggaggccaaaagttaaacgttctaaaaagaggcgaaag
gaagcaagcagttcagaagagccaaggaataaacatgcaatgaacccaaaaggtcactct
gagaggagtgataccaatgaaaaaaggtcagttgattccagtgctaaaagggaaaaacct
gtggtccgcccagaagagattcctccagtgcctgagaaccgatttttactgagaagagat
atgcctgttgttactgcagaacctgaaccgaagattcctgatgttgcacccattgtaagt
gatcagaaaccatctgtatcaaagtctggacggaagattaaaggaaggggcacaattcgc
tatcacacacctccaagatcaagatcctgttctgagtcagatgatgatgacagcagtgaa
actcctcctcactggaaagaggaaatgcagagattaagagcatatagaccacctagtgga
gaaaaatggagtaaaggagataagttaagtgacccctgttcaagccgatgggatgaaaga
agcttgtctcagagatccagatcatggtcctataatggatattattcagaccttagtaca
gcaagacactctggccaccataaaaaacgcagaaaagaaaaaaaggttaagcataaaaag
aaagggaaaaagcagaaacactgcagaagacacaaacaaacaaagaagagaaggattctt
ataccgtctgacatagaatcctcaaaatcttccactcgaagaatgaaatcctcttgtgat
agagaaaggagttctcgttcttcctcattgtcatctcatcactcatcaaagagagactgg
tctaaatctgataaggatgtccagagctctttaacccattccagcagagactcatacaga
tcaaaatctcactcacagtcttattctagaggaagctcaagatcaaggactgcgtcaaag
tcctcatcacattctcgaagtagatcaaagtccagatctagttccaagtctgggcaccga
aagagagcatcaaaatcaccaagaaaaacagcttctcagttaagtgaaaataaaccagtt
aaaacagaacctttaagagcaaccatggcacaaaatgaaaatgtagtagtacaaccagtt
gtagcagaaaatattcctgtaataccactgagtgacagtccccccccttcaagatggaag
cctggacagaaaccttggaagccctcttatgagcgaattcaggaaatgaaagctaaaaca
acccatttgctacccatccaaagcacttacagtttagcaaatattaaagagactggtagc
tcatcatcctaccataaaagagaaaaaaattcggaaagtgatcagagcacttattcaaaa
tacagtgatagaagttcagaaagctcaccaaggtcaaggagcagatcttctaggagtaga
tcttattccagatcatatacaagatcacgtagtctagctagttcacattcaaggtctagg
tctccatcatctagatctcattcacgaaataaatacagtgatcattcacagtgtagtaga
tcatcttcatatacttctattagcagtgatgatggaaggcgagctaagaggagacttaga
tccagtgggaaaaaaaatagcgtttcacataaaaagcatagcagcagctctgaaaagaca
cttcacagtaaatatgtcaaaggtagagacaggtcttcatgtgtgagaaagtatagcgag
agcagatcatctttagattattcttcagacagtgagcagtcaagtgttcaggccacacag
tcagcccaggaaaaagagaagcagggccaaatggaaagaacacataataaacaagaaaaa
aacagaggtgaagaaaaatccaagtctgaacgggaatgccctcattcaaaaaaaagaact
ttgaaagagaatctttctgatcaccttagaaatggcagtaagcccaaaaggaagaattat
gctggtagtaaatgggactctgagtcaaattcagaacgagatgtcactaaaaacagtaaa
aatgactcccatccatcctctgacaaggaagaaggtgaggccacatccgattctgaatca
gaggttagtgaaattcacatcaaagtcaaacccacaaccaagtcgtccacaaatacttca
ctgcctgatgataatggtgcttggaaatcaagcaaacagcgcacatcaacttctgactct
gaggggtcctgttccaattcggaaaacaataggggaaagccacaaaagcacaaacatggg
tcaaaggaaaatcttaaaagagaacacaccaaaaaagtgaaagagaaattgaaagggaaa
aaagacaaaaagcataaggctccaaaacgaaagcaagcatttcactggcagcctccacta
gaatttggtgaagaggaggaggaggagattgatgacaagcaagttactcaggaatcaaaa
gagaaaaaagtttctgaaaacaatgaaaccataaaagataatattctaaaaactgagaaa
tccagtgaagaggacctttcaggtaaacatgatacagtgactgtttcatcagatcttgat
cagtttactaaagatgatagtaaactcagtatttctcccacagctttaaatactgaggaa
aatgtggcctgtttacaaaacattcagcacgttgaagaaagtgttcccaatggagtggaa
gatgtgcttcaaacagatgacaacatggagatctgcactcctgataggagttccccagca
aaagtagaggagacttcccctctaggaaatgcacggcttgataccccagatataaacatt
gttttgaagcaggatatggcaacggaacatcctcaagcagaggtagtaaaacaggaaagc
agcatgtccgaaagtaaagtgttgggtgaagtggggaaacaggacagcagctctgctagc
ttggctagtgctggagaaagtaccgggaagaaggaggtggctgagaagagccagatcaac
ctcattgataagaaatggaagcccctgcaaggtgtggggaacctggcagcacctaatgct
gccacatccagtgctgtggaagttaaggtgttgaccactgtgcctgaaatgaaaccacaa
ggcttgagaatagaaattaaaagcaaaaataaagttcggcctgggtctctctttgatgaa
gtaagaaagacagcacgcttaaaccgtagaccaagaaatcaggagagttcaagtgatgag
cagacgcctagtcgggatgatgatagccagtccaggagtccaagtagatctcgaagtaaa
tctgaaaccaaatcaagacacagaacaaggtctgtctcctatagtcactcaagaagtcga
tcgagaagttccacatcatcttatcgatcaagaagctactctagaagtcggagcagagga
tggtacagcagaggccgaaccagaagccggagcagttcctaccggagttacaaaagtcac
aggacgtccagcaggagcagatccaggagcagctcatatgatccccacagtcgatccagg
tcctacacctacgatagctactatagcaggagtcggagtcgaagtagaagccagagaagt
gacagttaccaccgaggcagaagttataatcggcggtccaggagttgtagatcttatggc
tctgacagtgaaagtgaccgaagttactctcatcaccggagccccagtgagagcagcaga
tacagttga

DBGET integrated database retrieval system