KEGG   Homo sapiens (human): 4828
Entry
4828              CDS       T01001                                 
Symbol
NMB
Name
(RefSeq) neuromedin B
  KO
K05223  neuromedin B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    4828 (NMB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and neuropeptides [BR:hsa04052]
    4828 (NMB)
Cytokines and neuropeptides [BR:hsa04052]
 Neuropeptides
  Neuropeptides (GPCR binding)
   4828 (NMB)
SSDB
Motif
Pfam: Bombesin
Other DBs
NCBI-GeneID: 4828
NCBI-ProteinID: NP_066563
OMIM: 162340
HGNC: 7842
Ensembl: ENSG00000197696
CPD: C15865
UniProt: P08949
Position
15:complement(84655132..84658199)
AA seq 121 aa
MARRAGGARMFGSLLLFALLAAGVAPLSWDLPEPRSRASKIRVHSRGNLWATGHFMGKKS
LEPSSPSPLGTAPHTSLRDQRLQLSHDLLGILLLKKALGVSLSRPAPQIQYRRLLVQILQ
K
NT seq 366 nt   +upstreamnt  +downstreamnt
atggcccggcgggcggggggcgctcggatgttcggcagcctcctgctcttcgccctgctc
gctgccggcgtcgccccgctcagctgggatctcccggagccccgcagccgagccagcaag
atccgagtgcactcgcgaggcaacctctgggccaccggtcacttcatgggcaagaagagt
ctggagccttccagcccatccccattggggacagctccccacacctccctgagggaccag
cgactgcagctgagtcatgatctgctcggaatcctcctgctaaagaaggctctgggcgtg
agcctcagccgccccgcaccccaaatccagtacaggaggctgctggtacaaatactgcag
aaatga

DBGET integrated database retrieval system