KEGG   Homo sapiens (human): 4829Help
Entry
4829              CDS       T01001                                 

Gene name
NMBR, BB1, BB1R, NMB-R
Definition
(RefSeq) neuromedin B receptor
  KO
K04168  neuromedin B receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    4829 (NMBR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    4829 (NMBR)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Bombesin
    4829 (NMBR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srv 7tm_4
Motif
Other DBs
NCBI-GeneID: 4829
NCBI-ProteinID: NP_002502
OMIM: 162341
HGNC: 7843
Ensembl: ENSG00000135577
Vega: OTTHUMG00000015704
Pharos: P28336(Tchem)
UniProt: P28336
Position
6q24.1
AA seq 390 aa AA seqDB search
MPSKSLSNLSVTTGANESGSVPEGWERDFLPASDGTTTELVIRCVIPSLYLLIITVGLLG
NIMLVKIFITNSAMRSVPNIFISNLAAGDLLLLLTCVPVDASRYFFDEWMFGKVGCKLIP
VIQLTSVGVSVFTLTALSADRYRAIVNPMDMQTSGALLRTCVKAMGIWVVSVLLAVPEAV
FSEVARISSLDNSSFTACIPYPQTDELHPKIHSVLIFLVYFLIPLAIISIYYYHIAKTLI
KSAHNLPGEYNEHTKKQMETRKRLAKIVLVFVGCFIFCWFPNHILYMYRSFNYNEIDPSL
GHMIVTLVARVLSFGNSCVNPFALYLLSESFRRHFNSQLCCGRKSYQERGTSYLLSSSAV
RMTSLKSNAKNMVTNSVLLNGHSMKQEMAL
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgccctctaagtctctttccaacctctcggtgaccaccggcgcgaatgagagcggttcc
gttcccgaggggtgggaaagggatttcctgccggcctcggacgggaccaccacggagttg
gtgatccgctgtgtgatcccgtccctctacctgctcatcatcaccgtgggcttgctgggc
aacatcatgctggtgaagatcttcatcaccaacagcgccatgaggagcgtccccaacatc
ttcatctctaacctggcggccggggacttgctgctgctgctcacctgcgtcccggtggac
gcctcgcgctacttcttcgacgagtggatgtttggcaaggtgggctgcaaactgatccct
gtcatccagctcacttccgtgggggtttccgtgttcactctcactgccctcagcgccgac
aggtacagagccatcgttaaccccatggacatgcagacgtcaggggcattgctgcggacc
tgtgtgaaggccatgggtatctgggtggtctccgtgttgctggcagttcccgaagcggtg
ttttcagaagtggctcgcatcagtagcttggataatagcagcttcacagcatgtatccca
taccctcaaacagatgaattacatccaaagattcattcagtgctcattttcttggtctat
ttcctcataccacttgctattattagcatttattattatcatattgcaaagaccttaatt
aaaagcgcacacaatcttcctggagaatacaatgaacataccaaaaaacagatggaaaca
cggaaacgcctggctaaaattgtgcttgtctttgtgggctgtttcatcttctgttggttt
ccaaaccacatcctttacatgtatcggtctttcaactataatgagattgatccatctcta
ggccacatgattgtcaccttagttgcccgggttctcagttttggcaattcttgtgtcaac
ccatttgctctttacctactcagtgaaagcttcaggaggcatttcaacagccaactctgc
tgtgggaggaagtcctatcaagagagaggaaccagctacctactcagctcttcagcggtg
cgtatgacatctctgaaaagcaatgctaagaacatggtgaccaattctgttttactaaat
gggcacagcatgaagcaggaaatggcactgtga

DBGET integrated database retrieval system