KEGG   Homo sapiens (human): 4833
Entry
4833              CDS       T01001                                 
Symbol
NME4, NDPK-D, NM23H4, nm23-H4
Name
(RefSeq) NME/NM23 nucleoside diphosphate kinase 4
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa00240  Pyrimidine metabolism
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa01232  Nucleotide metabolism
hsa01240  Biosynthesis of cofactors
Module
hsa_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
hsa_M00050  Guanine ribonucleotide biosynthesis, IMP => GDP,GTP
hsa_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
hsa_M00053  Deoxyribonucleotide biosynthesis, ADP/GDP/CDP/UDP => dATP/dGTP/dCTP/dUTP
hsa_M00938  Pyrimidine deoxyribonucleotide biosynthesis, UDP => dTTP
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4833 (NME4)
   00240 Pyrimidine metabolism
    4833 (NME4)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    4833 (NME4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    4833 (NME4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     4833 (NME4)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    4833 (NME4)
SSDB
Motif
Pfam: NDK PSI_PsaJ
Other DBs
NCBI-GeneID: 4833
NCBI-ProteinID: NP_005000
OMIM: 601818
HGNC: 7852
Ensembl: ENSG00000103202
UniProt: O00746
Position
16:396729..400754
AA seq 187 aa
MGGLFWRSALRGLRCGPRAPGPSLLVRHGSGGPSWTRERTLVAVKPDGVQRRLVGDVIQR
FERRGFTLVGMKMLQAPESVLAEHYQDLRRKPFYPALIRYMSSGPVVAMVWEGYNVVRAS
RAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSVEGAQREIQLWFQSSELVSWADGGQ
HSSIHPA
NT seq 564 nt   +upstreamnt  +downstreamnt
atgggcggcctcttctggcgctccgcgctgcgggggctgcgctgcggcccgcgggccccg
ggcccgagcctgctagtgcgccacggctcgggagggccctcctggacccgggagcggacc
ctggtggcggtgaagcccgatggcgtgcaacggcggctcgttggggacgtgatccagcgc
tttgagaggcggggcttcacgctggtggggatgaagatgctgcaggcaccagagagcgtc
cttgccgagcactaccaggacctgcggaggaagcccttctaccctgccctcatccgctac
atgagctctgggcctgtggtggccatggtctgggaagggtacaatgtcgtccgcgcctcg
agggccatgattggacacaccgactcggctgaggctgccccaggaaccataaggggtgac
ttcagcgtccacatcagcaggaatgtcatccacgccagcgactccgtggagggggcccag
cgggagatccagctgtggttccagagcagtgagctggtgagctgggcagacgggggccag
cacagcagcatccacccagcctga

DBGET integrated database retrieval system