KEGG   Homo sapiens (human): 4835Help
Entry
4835              CDS       T01001                                 

Gene name
NQO2, DHQV, DIA6, NMOR2, QR2
Definition
(RefSeq) N-ribosyldihydronicotinamide:quinone reductase 2
  KO
K08071  ribosyldihydronicotinamide dehydrogenase (quinone) [EC:1.10.5.1]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    4835 (NQO2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.10  Acting on diphenols and related substances as donors
   1.10.5  With a quinone or related compound as acceptor
    1.10.5.1  ribosyldihydronicotinamide dehydrogenase (quinone)
     4835 (NQO2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Flavodoxin_2 FMN_red
Motif
Other DBs
NCBI-GeneID: 4835
NCBI-ProteinID: NP_000895
OMIM: 160998
HGNC: 7856
Ensembl: ENSG00000124588
Vega: OTTHUMG00000014130
Pharos: P16083(Tchem)
UniProt: P16083 B3KPX6
Structure
PDB: 

Position
6p25.2
AA seq 231 aa AA seqDB search
MAGKKVLIVYAHQEPKSFNGSLKNVAVDELSRQGCTVTVSDLYAMNLEPRATDKDITGTL
SNPEVFNYGVETHEAYKQRSLASDITDEQKKVREADLVIFQFPLYWFSVPAILKGWMDRV
LCQGFAFDIPGFYDSGLLQGKLALLSVTTGGTAEMYTKTGVNGDSRYFLWPLQHGTLHFC
GFKVLAPQISFAPEIASEEERKGMVAAWSQRLQTIWKEEPIPCTAHWHFGQ
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggcaggtaagaaagtactcattgtctatgcacaccaggaacccaagtctttcaacgga
tccttgaagaatgtggctgtagatgaactgagcaggcagggctgcaccgtcacagtgtct
gatttgtatgccatgaaccttgagccgagggccacagacaaagatatcactggtactctt
tctaatcctgaggttttcaattatggagtggaaacccacgaagcctacaagcaaaggtct
ctggctagcgacatcactgatgagcagaaaaaggttcgggaggctgacctagtgatattt
cagttcccgctgtactggttcagcgtgccagccatcctgaagggctggatggatagggtg
ctgtgccagggctttgcctttgacatcccaggattctacgattccggtttgctccagggt
aaactagcgctcctttccgtaaccacgggaggcacggccgagatgtacacgaagacagga
gtcaatggagattctcgatacttcctgtggccactccagcatggcacattacacttctgt
ggatttaaagtccttgcccctcagatcagctttgctcctgaaattgcatccgaagaagaa
agaaaggggatggtggctgcgtggtcccagaggctgcagaccatctggaaggaagagccc
atcccctgcacagcccactggcacttcgggcaataa

DBGET integrated database retrieval system