KEGG   Homo sapiens (human): 4835
Entry
4835              CDS       T01001                                 
Symbol
NQO2, DHQV, DIA6, NMOR2, QR2
Name
(RefSeq) N-ribosyldihydronicotinamide:quinone dehydrogenase 2
  KO
K08071  ribosyldihydronicotinamide dehydrogenase (quinone) [EC:1.10.5.1]
Organism
hsa  Homo sapiens (human)
Disease
H00031  Breast cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    4835 (NQO2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.10  Acting on diphenols and related substances as donors
   1.10.5  With a quinone or related compound as acceptor
    1.10.5.1  ribosyldihydronicotinamide dehydrogenase (quinone)
     4835 (NQO2)
SSDB
Motif
Pfam: Flavodoxin_2 FMN_red Flavodoxin_4
Other DBs
NCBI-GeneID: 4835
NCBI-ProteinID: NP_000895
OMIM: 160998
HGNC: 7856
Ensembl: ENSG00000124588
UniProt: P16083 B3KPX6
Structure
Position
6:2999894..3019755
AA seq 231 aa
MAGKKVLIVYAHQEPKSFNGSLKNVAVDELSRQGCTVTVSDLYAMNLEPRATDKDITGTL
SNPEVFNYGVETHEAYKQRSLASDITDEQKKVREADLVIFQFPLYWFSVPAILKGWMDRV
LCQGFAFDIPGFYDSGLLQGKLALLSVTTGGTAEMYTKTGVNGDSRYFLWPLQHGTLHFC
GFKVLAPQISFAPEIASEEERKGMVAAWSQRLQTIWKEEPIPCTAHWHFGQ
NT seq 696 nt   +upstreamnt  +downstreamnt
atggcaggtaagaaagtactcattgtctatgcacaccaggaacccaagtctttcaacgga
tccttgaagaatgtggctgtagatgaactgagcaggcagggctgcaccgtcacagtgtct
gatttgtatgccatgaaccttgagccgagggccacagacaaagatatcactggtactctt
tctaatcctgaggttttcaattatggagtggaaacccacgaagcctacaagcaaaggtct
ctggctagcgacatcactgatgagcagaaaaaggttcgggaggctgacctagtgatattt
cagttcccgctgtactggttcagcgtgccagccatcctgaagggctggatggatagggtg
ctgtgccagggctttgcctttgacatcccaggattctacgattccggtttgctccagggt
aaactagcgctcctttccgtaaccacgggaggcacggccgagatgtacacgaagacagga
gtcaatggagattctcgatacttcctgtggccactccagcatggcacattacacttctgt
ggatttaaagtccttgcccctcagatcagctttgctcctgaaattgcatccgaagaagaa
agaaaggggatggtggctgcgtggtcccagaggctgcagaccatctggaaggaagagccc
atcccctgcacagcccactggcacttcgggcaataa

DBGET integrated database retrieval system