KEGG   Homo sapiens (human): 4836Help
Entry
4836              CDS       T01001                                 

Gene name
NMT1, NMT
Definition
(RefSeq) N-myristoyltransferase 1
  KO
K00671  glycylpeptide N-tetradecanoyltransferase [EC:2.3.1.97]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    4836 (NMT1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.97  glycylpeptide N-tetradecanoyltransferase
     4836 (NMT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NMT_C NMT Acetyltransf_1 Acetyltransf_9 SR-25 NST1 CMS1
Motif
Other DBs
NCBI-GeneID: 4836
NCBI-ProteinID: NP_066565
OMIM: 160993
HGNC: 7857
Ensembl: ENSG00000136448
Vega: OTTHUMG00000180003
Pharos: P30419(Tchem)
UniProt: P30419
Structure
PDB: 

Position
17q21.31
AA seq 496 aa AA seqDB search
MADESETAVKPPAPPLPQMMEGNGNGHEHCSDCENEEDNSYNRGGLSPANDTGAKKKKKK
QKKKKEKGSETDSAQDQPVKMNSLPAERIQEIQKAIELFSVGQGPAKTMEEASKRSYQFW
DTQPVPKLGEVVNTHGPVEPDKDNIRQEPYTLPQGFTWDALDLGDRGVLKELYTLLNENY
VEDDDNMFRFDYSPEFLLWALRPPGWLPQWHCGVRVVSSRKLVGFISAIPANIHIYDTEK
KMVEINFLCVHKKLRSKRVAPVLIREITRRVHLEGIFQAVYTAGVVLPKPVGTCRYWHRS
LNPRKLIEVKFSHLSRNMTMQRTMKLYRLPETPKTAGLRPMETKDIPVVHQLLTRYLKQF
HLTPVMSQEEVEHWFYPQENIIDTFVVENANGEVTDFLSFYTLPSTIMNHPTHKSLKAAY
SFYNVHTQTPLLDLMSDALVLAKMKGFDVFNALDLMENKTFLEKLKFGIGDGNLQYYLYN
WKCPSMGAEKVGLVLQ
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgagagtgagacagcagtgaagccgccggcacctccgctgccgcagatgatg
gaagggaacgggaacggccatgagcactgcagcgattgcgagaatgaggaggacaacagc
tacaaccggggtggtttgagtccagccaatgacactggagccaaaaagaagaaaaagaaa
caaaaaaagaagaaagaaaaaggcagtgagacagattcagcccaggatcagcctgtgaag
atgaactctttgccagcagagaggatccaggaaatacagaaggccattgagctgttctca
gtgggtcagggacctgccaaaaccatggaggaggctagcaagcgaagctaccagttctgg
gatacgcagcccgtccccaagctgggcgaagtggtgaacacccatggccccgtggagcct
gacaaggacaatatccgccaggagccctacaccctgccccagggcttcacctgggatgct
ttggacctgggcgatcgtggtgtgctaaaagaactgtacaccctcctgaatgagaactat
gtggaagatgatgacaacatgttccgatttgattattccccggagtttcttttgtgggct
ctccggccacccggctggctcccccagtggcactgtggggttcgagtggtctcaagtcgg
aaattggttgggttcattagcgccatcccagcaaacatccatatctatgacacagagaag
aagatggtagagatcaacttcctgtgtgtccacaagaagctgcgttccaagagggttgct
ccagttctgatccgagagatcaccaggcgggttcacctggagggcatcttccaagcagtt
tacactgccggggtggtactaccaaagcccgttggcacctgcaggtattggcatcggtcc
ctaaacccacggaagctgattgaagtgaagttctcccacctgagcagaaatatgaccatg
cagcgcaccatgaagctctaccgactgccagagactcccaagacagctgggctgcgacca
atggaaacaaaggacattccagtagtgcaccagctcctcaccaggtacttgaagcaattt
caccttacgcccgtcatgagccaggaggaggtggagcactggttctacccccaggagaat
atcatcgacactttcgtggtggagaacgcaaacggagaggtgacagatttcctgagcttt
tatacgctgccctccaccatcatgaaccatccaacccacaagagtctcaaagctgcttat
tctttctacaacgttcacacccagacccctcttctagacctcatgagcgacgcccttgtc
ctcgccaaaatgaaagggtttgatgtgttcaatgcactggatctcatggagaacaaaacc
ttcctggagaagctcaagtttggcataggggacggcaacctgcagtattacctttacaat
tggaaatgccccagcatgggggcagagaaggttggactggtgctacaataa

DBGET integrated database retrieval system