KEGG   Homo sapiens (human): 4837
Entry
4837              CDS       T01001                                 
Symbol
NNMT
Name
(RefSeq) nicotinamide N-methyltransferase
  KO
K00541  nicotinamide N-methyltransferase [EC:2.1.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00760  Nicotinate and nicotinamide metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    4837 (NNMT)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    4837 (NNMT)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.1  nicotinamide N-methyltransferase
     4837 (NNMT)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   Other histone modification proteins
    4837 (NNMT)
SSDB
Motif
Pfam: NNMT_PNMT_TEMT Methyltransf_23 Methyltransf_12 Methyltransf_11
Other DBs
NCBI-GeneID: 4837
NCBI-ProteinID: NP_006160
OMIM: 600008
HGNC: 7861
Ensembl: ENSG00000166741
UniProt: P40261 B0YJ53
Position
11:114257806..114313536
AA seq 264 aa
MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLI
DIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKKEPEAFDWSPVVTYVCDLEGN
RVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRAL
RNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQ
SYSSTMANNEGLFSLVARKLSRPL
NT seq 795 nt   +upstreamnt  +downstreamnt
atggaatcaggcttcacctccaaggacacctatctaagccattttaaccctcgggattac
ctagaaaaatattacaagtttggttctaggcactctgcagaaagccagattcttaagcac
cttctgaaaaatcttttcaagatattctgcctagacggtgtgaagggagacctgctgatt
gacatcggctctggccccactatctatcagctcctctctgcttgtgaatcctttaaggag
atcgtcgtcactgactactcagaccagaacctgcaggagctggagaagtggctgaagaaa
gagccagaggcctttgactggtccccagtggtgacctatgtgtgtgatcttgaagggaac
agagtcaagggtccagagaaggaggagaagttgagacaggcggtcaagcaggtgctgaag
tgtgatgtgactcagagccagccactgggggccgtccccttacccccggctgactgcgtg
ctcagcacactgtgtctggatgccgcctgcccagacctccccacctactgcagggcgctc
aggaacctcggcagcctactgaagccagggggcttcctggtgatcatggatgcgctcaag
agcagctactacatgattggtgagcagaagttctccagcctccccctgggccgggaggca
gtagaggctgctgtgaaagaggctggctacacaatcgaatggtttgaggtgatctcgcaa
agttattcttccaccatggccaacaacgaaggacttttctccctggtggcgaggaagctg
agcagacccctgtga

DBGET integrated database retrieval system