KEGG   Homo sapiens (human): 4842Help
Entry
4842              CDS       T01001                                 

Gene name
NOS1, IHPS1, N-NOS, NC-NOS, NOS, bNOS, nNOS
Definition
(RefSeq) nitric oxide synthase 1
  KO
K13240  nitric-oxide synthase, brain [EC:1.14.13.39]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00220  Arginine biosynthesis
hsa00330  Arginine and proline metabolism
hsa01100  Metabolic pathways
hsa04020  Calcium signaling pathway
hsa04145  Phagosome
hsa04371  Apelin signaling pathway
hsa04713  Circadian entrainment
hsa04730  Long-term depression
hsa04926  Relaxin signaling pathway
hsa04970  Salivary secretion
hsa05010  Alzheimer disease
hsa05014  Amyotrophic lateral sclerosis (ALS)
Drug target
Pimagedine hydrochloride: D05479
Tilarginine acetate: D09018
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    4842 (NOS1)
   00330 Arginine and proline metabolism
    4842 (NOS1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    4842 (NOS1)
   04020 Calcium signaling pathway
    4842 (NOS1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    4842 (NOS1)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    4842 (NOS1)
  09154 Digestive system
   04970 Salivary secretion
    4842 (NOS1)
  09156 Nervous system
   04730 Long-term depression
    4842 (NOS1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    4842 (NOS1)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    4842 (NOS1)
   05014 Amyotrophic lateral sclerosis (ALS)
    4842 (NOS1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     4842 (NOS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 PDZ PDZ_2
Motif
Other DBs
NCBI-GeneID: 4842
NCBI-ProteinID: NP_000611
OMIM: 163731
HGNC: 7872
Ensembl: ENSG00000089250
Vega: OTTHUMG00000137376
Pharos: P29475(Tchem)
UniProt: P29475 B3VK56 B4DG68 A0PJJ7
Structure
PDB: 

Position
12q24.22
AA seq 1434 aa AA seqDB search
MEDHMFGVQQIQPNVISVRLFKRKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSGLIQA
GDIILAVNGRPLVDLSYDSALEVLRGIASETHVVLILRGPEGFTTHLETTFTGDGTPKTI
RVTQPLGPPTKAVDLSHQPPAGKEQPLAVDGASGPGNGPQHAYDDGQEAGSLPHANGLAP
RPPGQDPAKKATRVSLQGRGENNELLKEIEPVLSLLTSGSRGVKGGAPAKAEMKDMGIQV
DRDLDGKSHKPLPLGVENDRVFNDLWGKGNVPVVLNNPYSEKEQPPTSGKQSPTKNGSPS
KCPRFLKVKNWETEVVLTDTLHLKSTLETGCTEYICMGSIMHPSQHARRPEDVRTKGQLF
PLAKEFIDQYYSSIKRFGSKAHMERLEEVNKEIDTTSTYQLKDTELIYGAKHAWRNASRC
VGRIQWSKLQVFDARDCTTAHGMFNYICNHVKYATNKGNLRSAITIFPQRTDGKHDFRVW
NSQLIRYAGYKQPDGSTLGDPANVQFTEICIQQGWKPPRGRFDVLPLLLQANGNDPELFQ
IPPELVLEVPIRHPKFEWFKDLGLKWYGLPAVSNMLLEIGGLEFSACPFSGWYMGTEIGV
RDYCDNSRYNILEEVAKKMNLDMRKTSSLWKDQALVEINIAVLYSFQSDKVTIVDHHSAT
ESFIKHMENEYRCRGGCPADWVWIVPPMSGSITPVFHQEMLNYRLTPSFEYQPDPWNTHV
WKGTNGTPTKRRAIGFKKLAEAVKFSAKLMGQAMAKRVKATILYATETGKSQAYAKTLCE
IFKHAFDAKVMSMEEYDIVHLEHETLVLVVTSTFGNGDPPENGEKFGCALMEMRHPNSVQ
EERKSYKVRFNSVSSYSDSQKSSGDGPDLRDNFESAGPLANVRFSVFGLGSRAYPHFCAF
GHAVDTLLEELGGERILKMREGDELCGQEEAFRTWAKKVFKAACDVFCVGDDVNIEKANN
SLISNDRSWKRNKFRLTFVAEAPELTQGLSNVHKKRVSAARLLSRQNLQSPKSSRSTIFV
RLHTNGSQELQYQPGDHLGVFPGNHEDLVNALIERLEDAPPVNQMVKVELLEERNTALGV
ISNWTDELRLPPCTIFQAFKYYLDITTPPTPLQLQQFASLATSEKEKQRLLVLSKGLQEY
EEWKWGKNPTIVEVLEEFPSIQMPATLLLTQLSLLQPRYYSISSSPDMYPDEVHLTVAIV
SYRTRDGEGPIHHGVCSSWLNRIQADELVPCFVRGAPSFHLPRNPQVPCILVGPGTGIAP
FRSFWQQRQFDIQHKGMNPCPMVLVFGCRQSKIDHIYREETLQAKNKGVFRELYTAYSRE
PDKPKKYVQDILQEQLAESVYRALKEQGGHIYVCGDVTMAADVLKAIQRIMTQQGKLSAE
DAGVFISRMRDDNRYHEDIFGVTLRTYEVTNRLRSESIAFIEESKKDTDEVFSS
NT seq 4305 nt NT seq  +upstreamnt  +downstreamnt
atggaggatcacatgttcggtgttcagcaaatccagcccaatgtcatttctgttcgtctc
ttcaagcgcaaagttgggggcctgggatttctggtgaaggagcgggtcagtaagccgccc
gtgatcatctctgacctgattcgtgggggcgccgcagagcagagtggcctcatccaggcc
ggagacatcattcttgcggtcaacggccggcccttggtggacctgagctatgacagcgcc
ctggaggtactcagaggcattgcctctgagacccacgtggtcctcattctgaggggccct
gaaggtttcaccacgcacctggagaccacctttacaggtgatgggacccccaagaccatc
cgggtgacacagcccctgggtccccccaccaaagccgtggatctgtcccaccagccaccg
gccggcaaagaacagcccctggcagtggatggggcctcgggtcccgggaatgggcctcag
catgcctacgatgatgggcaggaggctggctcactcccccatgccaacggcctggccccc
aggcccccaggccaggaccccgcgaagaaagcaaccagagtcagcctccaaggcagaggg
gagaacaatgaactgctcaaggagatagagcctgtgctgagccttctcaccagtgggagc
agaggggtcaagggaggggcacctgccaaggcagagatgaaagatatgggaatccaggtg
gacagagatttggacggcaagtcacacaaacctctgcccctcggcgtggagaacgaccga
gtcttcaatgacctatgggggaagggcaatgtgcctgtcgtcctcaacaacccatattca
gagaaggagcagccccccacctcaggaaaacagtcccccacaaagaatggcagcccctcc
aagtgtccacgcttcctcaaggtcaagaactgggagactgaggtggttctcactgacacc
ctccaccttaagagcacattggaaacgggatgcactgagtacatctgcatgggctccatc
atgcatccttctcagcatgcaaggaggcctgaagacgtccgcacaaaaggacagctcttc
cctctcgccaaagagtttattgatcaatactattcatcaattaaaagatttggctccaaa
gcccacatggaaaggctggaagaggtgaacaaagagatcgacaccactagcacttaccag
ctcaaggacacagagctcatctatggggccaagcacgcctggcggaatgcctcgcgctgt
gtgggcaggatccagtggtccaagctgcaggtattcgatgcccgtgactgcaccacggcc
cacgggatgttcaactacatctgtaaccatgtcaagtatgccaccaacaaagggaacctc
aggtctgccatcaccatattcccccagaggacagacggcaagcacgacttccgagtctgg
aactcccagctcatccgctacgctggctacaagcagcctgacggctccaccctgggggac
ccagccaatgtgcagttcacagagatatgcatacagcagggctggaaaccgcctagaggc
cgcttcgatgtcctgccgctcctgcttcaggccaacggcaatgaccctgagctcttccag
attcctccagagctggtgttggaagttcccatcaggcaccccaagtttgagtggttcaag
gacctggggctgaagtggtacggcctccccgccgtgtccaacatgctcctagagattggc
ggcctggagttcagcgcctgtcccttcagtggctggtacatgggcacagagattggtgtc
cgcgactactgtgacaactcccgctacaatatcctggaggaagtggccaagaagatgaac
ttagacatgaggaagacgtcctccctgtggaaggaccaggcgctggtggagatcaatatc
gcggttctctatagcttccagagtgacaaagtgaccattgttgaccatcactccgccacc
gagtccttcattaagcacatggagaatgagtaccgctgccgggggggctgccctgccgac
tgggtgtggatcgtgccccccatgtccggaagcatcacccctgtgttccaccaggagatg
ctcaactaccggctcaccccctccttcgaataccagcctgatccctggaacacgcatgtc
tggaaaggcaccaacgggacccccacaaagcggcgagccattggcttcaagaagctagca
gaagctgtcaagttctcggccaagctgatggggcaggctatggccaagagggtgaaagcg
accatcctctatgccacagagacaggcaaatcgcaagcttatgccaagaccttgtgtgag
atcttcaaacacgcctttgatgccaaggtgatgtccatggaagaatatgacattgtgcac
ctggaacatgaaactctggtccttgtggtcaccagcacctttggcaatggagatccccct
gagaatggggagaaattcggctgtgctttgatggaaatgaggcaccccaactctgtgcag
gaagaaaggaagagctacaaggtccgattcaacagcgtctcctcctactctgactcccaa
aaatcatcaggcgatgggcccgacctcagagacaactttgagagtgctggacccctggcc
aatgtgaggttctcagtttttggcctcggctcacgagcataccctcacttttgcgccttc
ggacacgctgtggacaccctcctggaagaactgggaggggagaggatcctgaagatgagg
gaaggggatgagctctgtgggcaggaagaggctttcaggacctgggccaagaaggtcttc
aaggcagcctgtgatgtcttctgtgtgggagatgatgtcaacattgaaaaggccaacaat
tccctcatcagcaatgatcgcagctggaagagaaacaagttccgcctcacctttgtggcc
gaagctccagaactcacacaaggtctatccaatgtccacaaaaagcgagtctcagctgcc
cggctccttagccgtcaaaacctccagagccctaaatccagtcggtcaactatcttcgtg
cgtctccacaccaacgggagccaggagctgcagtaccagcctggggaccacctgggtgtc
ttccctggcaaccacgaggacctcgtgaatgccctgatcgagcggctggaggacgcgccg
cctgtcaaccagatggtgaaagtggaactgctggaggagcggaacacggctttaggtgtc
atcagtaactggacagacgagctccgcctcccgccctgcaccatcttccaggccttcaag
tactacctggacatcaccacgccaccaacgcctctgcagctgcagcagtttgcctcccta
gctaccagcgagaaggagaagcagcgtctgctggtcctcagcaagggtttgcaggagtac
gaggaatggaaatggggcaagaaccccaccatcgtggaggtgctggaggagttcccatct
atccagatgccggccaccctgctcctgacccagctgtccctgctgcagccccgctactat
tccatcagctcctccccagacatgtaccctgatgaagtgcacctcactgtggccatcgtt
tcctaccgcactcgagatggagaaggaccaattcaccacggcgtatgctcctcctggctc
aaccggatacaggctgacgaactggtcccctgtttcgtgagaggagcacccagcttccac
ctgccccggaacccccaagtcccctgcatcctcgttggaccaggcaccggcattgcccct
ttccgaagcttctggcaacagcggcaatttgatatccaacacaaaggaatgaacccctgc
cccatggtcctggtcttcgggtgccggcaatccaagatagatcatatctacagggaagag
accctgcaggccaagaacaagggggtcttcagagagctgtacacggcttactcccgggag
ccagacaaaccaaagaagtacgtgcaggacatcctgcaggagcagctggcggagtctgtg
taccgagccctgaaggagcaagggggccacatatacgtctgtggggacgtcaccatggct
gctgatgtcctcaaagccatccagcgcatcatgacccagcaggggaagctctcggcagag
gacgccggcgtattcatcagccggatgagggatgacaaccgataccatgaggatattttt
ggagtcaccctgcgaacgtacgaagtgaccaaccgccttagatctgagtccattgccttc
attgaagagagcaaaaaagacaccgatgaggttttcagctcctaa

DBGET integrated database retrieval system