KEGG   Homo sapiens (human): 4842Help
Entry
4842              CDS       T01001                                 

Gene name
NOS1, IHPS1, N-NOS, NC-NOS, NOS, bNOS, nNOS
Definition
(RefSeq) nitric oxide synthase 1
  KO
K13240  nitric-oxide synthase, brain [EC:1.14.13.39]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00220  Arginine biosynthesis
hsa00330  Arginine and proline metabolism
hsa01100  Metabolic pathways
hsa04020  Calcium signaling pathway
hsa04145  Phagosome
hsa04371  Apelin signaling pathway
hsa04713  Circadian entrainment
hsa04730  Long-term depression
hsa04926  Relaxin signaling pathway
hsa04970  Salivary secretion
hsa05010  Alzheimer disease
hsa05014  Amyotrophic lateral sclerosis (ALS)
Drug target
Pimagedine hydrochloride: D05479
Tilarginine acetate: D09018
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    4842 (NOS1)
   00330 Arginine and proline metabolism
    4842 (NOS1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    4842 (NOS1)
   04020 Calcium signaling pathway
    4842 (NOS1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    4842 (NOS1)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    4842 (NOS1)
  09154 Digestive system
   04970 Salivary secretion
    4842 (NOS1)
  09156 Nervous system
   04730 Long-term depression
    4842 (NOS1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    4842 (NOS1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    4842 (NOS1)
   05014 Amyotrophic lateral sclerosis (ALS)
    4842 (NOS1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     4842 (NOS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 PDZ PDZ_6 PDZ_2
Motif
Other DBs
NCBI-GeneID: 4842
NCBI-ProteinID: NP_000611
OMIM: 163731
HGNC: 7872
Ensembl: ENSG00000089250
Vega: OTTHUMG00000137376
Pharos: P29475(Tchem)
UniProt: P29475 B3VK56 B4DG68 A0PJJ7
Structure
PDB: 

Position
12q24.22
AA seq 1434 aa AA seqDB search
MEDHMFGVQQIQPNVISVRLFKRKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSGLIQA
GDIILAVNGRPLVDLSYDSALEVLRGIASETHVVLILRGPEGFTTHLETTFTGDGTPKTI
RVTQPLGPPTKAVDLSHQPPAGKEQPLAVDGASGPGNGPQHAYDDGQEAGSLPHANGLAP
RPPGQDPAKKATRVSLQGRGENNELLKEIEPVLSLLTSGSRGVKGGAPAKAEMKDMGIQV
DRDLDGKSHKPLPLGVENDRVFNDLWGKGNVPVVLNNPYSEKEQPPTSGKQSPTKNGSPS
KCPRFLKVKNWETEVVLTDTLHLKSTLETGCTEYICMGSIMHPSQHARRPEDVRTKGQLF
PLAKEFIDQYYSSIKRFGSKAHMERLEEVNKEIDTTSTYQLKDTELIYGAKHAWRNASRC
VGRIQWSKLQVFDARDCTTAHGMFNYICNHVKYATNKGNLRSAITIFPQRTDGKHDFRVW
NSQLIRYAGYKQPDGSTLGDPANVQFTEICIQQGWKPPRGRFDVLPLLLQANGNDPELFQ
IPPELVLEVPIRHPKFEWFKDLGLKWYGLPAVSNMLLEIGGLEFSACPFSGWYMGTEIGV
RDYCDNSRYNILEEVAKKMNLDMRKTSSLWKDQALVEINIAVLYSFQSDKVTIVDHHSAT
ESFIKHMENEYRCRGGCPADWVWIVPPMSGSITPVFHQEMLNYRLTPSFEYQPDPWNTHV
WKGTNGTPTKRRAIGFKKLAEAVKFSAKLMGQAMAKRVKATILYATETGKSQAYAKTLCE
IFKHAFDAKVMSMEEYDIVHLEHETLVLVVTSTFGNGDPPENGEKFGCALMEMRHPNSVQ
EERKSYKVRFNSVSSYSDSQKSSGDGPDLRDNFESAGPLANVRFSVFGLGSRAYPHFCAF
GHAVDTLLEELGGERILKMREGDELCGQEEAFRTWAKKVFKAACDVFCVGDDVNIEKANN
SLISNDRSWKRNKFRLTFVAEAPELTQGLSNVHKKRVSAARLLSRQNLQSPKSSRSTIFV
RLHTNGSQELQYQPGDHLGVFPGNHEDLVNALIERLEDAPPVNQMVKVELLEERNTALGV
ISNWTDELRLPPCTIFQAFKYYLDITTPPTPLQLQQFASLATSEKEKQRLLVLSKGLQEY
EEWKWGKNPTIVEVLEEFPSIQMPATLLLTQLSLLQPRYYSISSSPDMYPDEVHLTVAIV
SYRTRDGEGPIHHGVCSSWLNRIQADELVPCFVRGAPSFHLPRNPQVPCILVGPGTGIAP
FRSFWQQRQFDIQHKGMNPCPMVLVFGCRQSKIDHIYREETLQAKNKGVFRELYTAYSRE
PDKPKKYVQDILQEQLAESVYRALKEQGGHIYVCGDVTMAADVLKAIQRIMTQQGKLSAE
DAGVFISRMRDDNRYHEDIFGVTLRTYEVTNRLRSESIAFIEESKKDTDEVFSS
NT seq 4305 nt NT seq  +upstreamnt  +downstreamnt
atggaggatcacatgttcggtgttcagcaaatccagcccaatgtcatttctgttcgtctc
ttcaagcgcaaagttgggggcctgggatttctggtgaaggagcgggtcagtaagccgccc
gtgatcatctctgacctgattcgtgggggcgccgcagagcagagtggcctcatccaggcc
ggagacatcattcttgcggtcaacggccggcccttggtggacctgagctatgacagcgcc
ctggaggtactcagaggcattgcctctgagacccacgtggtcctcattctgaggggccct
gaaggtttcaccacgcacctggagaccacctttacaggtgatgggacccccaagaccatc
cgggtgacacagcccctgggtccccccaccaaagccgtggatctgtcccaccagccaccg
gccggcaaagaacagcccctggcagtggatggggcctcgggtcccgggaatgggcctcag
catgcctacgatgatgggcaggaggctggctcactcccccatgccaacggcctggccccc
aggcccccaggccaggaccccgcgaagaaagcaaccagagtcagcctccaaggcagaggg
gagaacaatgaactgctcaaggagatagagcctgtgctgagccttctcaccagtgggagc
agaggggtcaagggaggggcacctgccaaggcagagatgaaagatatgggaatccaggtg
gacagagatttggacggcaagtcacacaaacctctgcccctcggcgtggagaacgaccga
gtcttcaatgacctatgggggaagggcaatgtgcctgtcgtcctcaacaacccatattca
gagaaggagcagccccccacctcaggaaaacagtcccccacaaagaatggcagcccctcc
aagtgtccacgcttcctcaaggtcaagaactgggagactgaggtggttctcactgacacc
ctccaccttaagagcacattggaaacgggatgcactgagtacatctgcatgggctccatc
atgcatccttctcagcatgcaaggaggcctgaagacgtccgcacaaaaggacagctcttc
cctctcgccaaagagtttattgatcaatactattcatcaattaaaagatttggctccaaa
gcccacatggaaaggctggaagaggtgaacaaagagatcgacaccactagcacttaccag
ctcaaggacacagagctcatctatggggccaagcacgcctggcggaatgcctcgcgctgt
gtgggcaggatccagtggtccaagctgcaggtattcgatgcccgtgactgcaccacggcc
cacgggatgttcaactacatctgtaaccatgtcaagtatgccaccaacaaagggaacctc
aggtctgccatcaccatattcccccagaggacagacggcaagcacgacttccgagtctgg
aactcccagctcatccgctacgctggctacaagcagcctgacggctccaccctgggggac
ccagccaatgtgcagttcacagagatatgcatacagcagggctggaaaccgcctagaggc
cgcttcgatgtcctgccgctcctgcttcaggccaacggcaatgaccctgagctcttccag
attcctccagagctggtgttggaagttcccatcaggcaccccaagtttgagtggttcaag
gacctggggctgaagtggtacggcctccccgccgtgtccaacatgctcctagagattggc
ggcctggagttcagcgcctgtcccttcagtggctggtacatgggcacagagattggtgtc
cgcgactactgtgacaactcccgctacaatatcctggaggaagtggccaagaagatgaac
ttagacatgaggaagacgtcctccctgtggaaggaccaggcgctggtggagatcaatatc
gcggttctctatagcttccagagtgacaaagtgaccattgttgaccatcactccgccacc
gagtccttcattaagcacatggagaatgagtaccgctgccgggggggctgccctgccgac
tgggtgtggatcgtgccccccatgtccggaagcatcacccctgtgttccaccaggagatg
ctcaactaccggctcaccccctccttcgaataccagcctgatccctggaacacgcatgtc
tggaaaggcaccaacgggacccccacaaagcggcgagccattggcttcaagaagctagca
gaagctgtcaagttctcggccaagctgatggggcaggctatggccaagagggtgaaagcg
accatcctctatgccacagagacaggcaaatcgcaagcttatgccaagaccttgtgtgag
atcttcaaacacgcctttgatgccaaggtgatgtccatggaagaatatgacattgtgcac
ctggaacatgaaactctggtccttgtggtcaccagcacctttggcaatggagatccccct
gagaatggggagaaattcggctgtgctttgatggaaatgaggcaccccaactctgtgcag
gaagaaaggaagagctacaaggtccgattcaacagcgtctcctcctactctgactcccaa
aaatcatcaggcgatgggcccgacctcagagacaactttgagagtgctggacccctggcc
aatgtgaggttctcagtttttggcctcggctcacgagcataccctcacttttgcgccttc
ggacacgctgtggacaccctcctggaagaactgggaggggagaggatcctgaagatgagg
gaaggggatgagctctgtgggcaggaagaggctttcaggacctgggccaagaaggtcttc
aaggcagcctgtgatgtcttctgtgtgggagatgatgtcaacattgaaaaggccaacaat
tccctcatcagcaatgatcgcagctggaagagaaacaagttccgcctcacctttgtggcc
gaagctccagaactcacacaaggtctatccaatgtccacaaaaagcgagtctcagctgcc
cggctccttagccgtcaaaacctccagagccctaaatccagtcggtcaactatcttcgtg
cgtctccacaccaacgggagccaggagctgcagtaccagcctggggaccacctgggtgtc
ttccctggcaaccacgaggacctcgtgaatgccctgatcgagcggctggaggacgcgccg
cctgtcaaccagatggtgaaagtggaactgctggaggagcggaacacggctttaggtgtc
atcagtaactggacagacgagctccgcctcccgccctgcaccatcttccaggccttcaag
tactacctggacatcaccacgccaccaacgcctctgcagctgcagcagtttgcctcccta
gctaccagcgagaaggagaagcagcgtctgctggtcctcagcaagggtttgcaggagtac
gaggaatggaaatggggcaagaaccccaccatcgtggaggtgctggaggagttcccatct
atccagatgccggccaccctgctcctgacccagctgtccctgctgcagccccgctactat
tccatcagctcctccccagacatgtaccctgatgaagtgcacctcactgtggccatcgtt
tcctaccgcactcgagatggagaaggaccaattcaccacggcgtatgctcctcctggctc
aaccggatacaggctgacgaactggtcccctgtttcgtgagaggagcacccagcttccac
ctgccccggaacccccaagtcccctgcatcctcgttggaccaggcaccggcattgcccct
ttccgaagcttctggcaacagcggcaatttgatatccaacacaaaggaatgaacccctgc
cccatggtcctggtcttcgggtgccggcaatccaagatagatcatatctacagggaagag
accctgcaggccaagaacaagggggtcttcagagagctgtacacggcttactcccgggag
ccagacaaaccaaagaagtacgtgcaggacatcctgcaggagcagctggcggagtctgtg
taccgagccctgaaggagcaagggggccacatatacgtctgtggggacgtcaccatggct
gctgatgtcctcaaagccatccagcgcatcatgacccagcaggggaagctctcggcagag
gacgccggcgtattcatcagccggatgagggatgacaaccgataccatgaggatattttt
ggagtcaccctgcgaacgtacgaagtgaccaaccgccttagatctgagtccattgccttc
attgaagagagcaaaaaagacaccgatgaggttttcagctcctaa

KEGG   Homo sapiens (human): 4843Help
Entry
4843              CDS       T01001                                 

Gene name
NOS2, HEP-NOS, INOS, NOS, NOS2A
Definition
(RefSeq) nitric oxide synthase 2
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00220  Arginine biosynthesis
hsa00330  Arginine and proline metabolism
hsa01100  Metabolic pathways
hsa04020  Calcium signaling pathway
hsa04066  HIF-1 signaling pathway
hsa04146  Peroxisome
hsa04371  Apelin signaling pathway
hsa04926  Relaxin signaling pathway
hsa05132  Salmonella infection
hsa05133  Pertussis
hsa05140  Leishmaniasis
hsa05142  Chagas disease (American trypanosomiasis)
hsa05145  Toxoplasmosis
hsa05146  Amoebiasis
hsa05152  Tuberculosis
hsa05200  Pathways in cancer
hsa05222  Small cell lung cancer
Disease
H00017  Esophageal cancer
Drug target
Cindunistat (DG01391): D10386 D10419
Pimagedine hydrochloride: D05479
Tilarginine acetate: D09018
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    4843 (NOS2)
   00330 Arginine and proline metabolism
    4843 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    4843 (NOS2)
   04066 HIF-1 signaling pathway
    4843 (NOS2)
   04020 Calcium signaling pathway
    4843 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    4843 (NOS2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    4843 (NOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    4843 (NOS2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    4843 (NOS2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    4843 (NOS2)
   05133 Pertussis
    4843 (NOS2)
   05152 Tuberculosis
    4843 (NOS2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    4843 (NOS2)
   05145 Toxoplasmosis
    4843 (NOS2)
   05140 Leishmaniasis
    4843 (NOS2)
   05142 Chagas disease (American trypanosomiasis)
    4843 (NOS2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     4843 (NOS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 NAD_binding_6
Motif
Other DBs
NCBI-GeneID: 4843
NCBI-ProteinID: NP_000616
OMIM: 163730
HGNC: 7873
Ensembl: ENSG00000007171
Vega: OTTHUMG00000132445
Pharos: P35228(Tchem)
UniProt: P35228
Structure
PDB: 

Position
17q11.2
AA seq 1153 aa AA seqDB search
MACPWKFLFKTKFHQYAMNGEKDINNNVEKAPCATSSPVTQDDLQYHNLSKQQNESPQPL
VETGKKSPESLVKLDATPLSSPRHVRIKNWGSGMTFQDTLHHKAKGILTCRSKSCLGSIM
TPKSLTRGPRDKPTPPDELLPQAIEFVNQYYGSFKEAKIEEHLARVEAVTKEIETTGTYQ
LTGDELIFATKQAWRNAPRCIGRIQWSNLQVFDARSCSTAREMFEHICRHVRYSTNNGNI
RSAITVFPQRSDGKHDFRVWNAQLIRYAGYQMPDGSIRGDPANVEFTQLCIDLGWKPKYG
RFDVVPLVLQANGRDPELFEIPPDLVLEVAMEHPKYEWFRELELKWYALPAVANMLLEVG
GLEFPGCPFNGWYMGTEIGVRDFCDVQRYNILEEVGRRMGLETHKLASLWKDQAVVEINI
AVLHSFQKQNVTIMDHHSAAESFMKYMQNEYRSRGGCPADWIWLVPPMSGSITPVFHQEM
LNYVLSPFYYYQVEAWKTHVWQDEKRRPKRREIPLKVLVKAVLFACMLMRKTMASRVRVT
ILFATETGKSEALAWDLGALFSCAFNPKVVCMDKYRLSCLEEERLLLVVTSTFGNGDCPG
NGEKLKKSLFMLKELNNKFRYAVFGLGSSMYPRFCAFAHDIDQKLSHLGASQLTPMGEGD
ELSGQEDAFRSWAVQTFKAACETFDVRGKQHIQIPKLYTSNVTWDPHHYRLVQDSQPLDL
SKALSSMHAKNVFTMRLKSRQNLQSPTSSRATILVELSCEDGQGLNYLPGEHLGVCPGNQ
PALVQGILERVVDGPTPHQTVRLEALDESGSYWVSDKRLPPCSLSQALTYFLDITTPPTQ
LLLQKLAQVATEEPERQRLEALCQPSEYSKWKFTNSPTFLEVLEEFPSLRVSAGFLLSQL
PILKPRFYSISSSRDHTPTEIHLTVAVVTYHTRDGQGPLHHGVCSTWLNSLKPQDPVPCF
VRNASGFHLPEDPSHPCILIGPGTGIAPFRSFWQQRLHDSQHKGVRGGRMTLVFGCRRPD
EDHIYQEEMLEMAQKGVLHAVHTAYSRLPGKPKVYVQDILRQQLASEVLRVLHKEPGHLY
VCGDVRMARDVAHTLKQLVAAKLKLNEEQVEDYFFQLKSQKRYHEDIFGAVFPYEAKKDR
VAVQPSSLEMSAL
NT seq 3462 nt NT seq  +upstreamnt  +downstreamnt
atggcctgtccttggaaatttctgttcaagaccaaattccaccagtatgcaatgaatggg
gaaaaagacatcaacaacaatgtggagaaagccccctgtgccacctccagtccagtgaca
caggatgaccttcagtatcacaacctcagcaagcagcagaatgagtccccgcagcccctc
gtggagacgggaaagaagtctccagaatctctggtcaagctggatgcaaccccattgtcc
tccccacggcatgtgaggatcaaaaactggggcagcgggatgactttccaagacacactt
caccataaggccaaagggattttaacttgcaggtccaaatcttgcctggggtccattatg
actcccaaaagtttgaccagaggacccagggacaagcctacccctccagatgagcttcta
cctcaagctatcgaatttgtcaaccaatattacggctccttcaaagaggcaaaaatagag
gaacatctggccagggtggaagcggtaacaaaggagatagaaacaacaggaacctaccaa
ctgacgggagatgagctcatcttcgccaccaagcaggcctggcgcaatgccccacgctgc
attgggaggatccagtggtccaacctgcaggtcttcgatgcccgcagctgttccactgcc
cgggaaatgtttgaacacatctgcagacacgtgcgttactccaccaacaatggcaacatc
aggtcggccatcaccgtgttcccccagcggagtgatggcaagcacgacttccgggtgtgg
aatgctcagctcatccgctatgctggctaccagatgccagatggcagcatcagaggggac
cctgccaacgtggaattcactcagctgtgcatcgacctgggctggaagcccaagtacggc
cgcttcgatgtggtccccctggtcctgcaggccaatggccgtgaccctgagctcttcgaa
atcccacctgaccttgtgcttgaggtggccatggaacatcccaaatacgagtggtttcgg
gaactggagctaaagtggtacgccctgcctgcagtggccaacatgctgcttgaggtgggc
ggcctggagttcccagggtgccccttcaatggctggtacatgggcacagagatcggagtc
cgggacttctgtgacgtccagcgctacaacatcctggaggaagtgggcaggagaatgggc
ctggaaacgcacaagctggcctcgctctggaaagaccaggctgtcgttgagatcaacatt
gctgtgctccatagtttccagaagcagaatgtgaccatcatggaccaccactcggctgca
gaatccttcatgaagtacatgcagaatgaataccggtcccgtgggggctgcccggcagac
tggatttggctggtccctcccatgtctgggagcatcacccccgtgtttcaccaggagatg
ctgaactacgtcctgtcccctttctactactatcaggtagaggcctggaaaacccatgtc
tggcaggacgagaagcggagacccaagagaagagagattccattgaaagtcttggtcaaa
gctgtgctctttgcctgtatgctgatgcgcaagacaatggcgtcccgagtcagagtcacc
atcctctttgcgacagagacaggaaaatcagaggcgctggcctgggacctgggggcctta
ttcagctgtgccttcaaccccaaggttgtctgcatggataagtacaggctgagctgcctg
gaggaggaacggctgctgttggtggtgaccagtacgtttggcaatggagactgccctggc
aatggagagaaactgaagaaatcgctcttcatgctgaaagagctcaacaacaaattcagg
tacgctgtgtttggcctcggctccagcatgtaccctcggttctgcgcctttgctcatgac
attgatcagaagctgtcccacctgggggcctctcagctcaccccgatgggagaaggggat
gagctcagtgggcaggaggacgccttccgcagctgggccgtgcaaaccttcaaggcagcc
tgtgagacgtttgatgtccgaggcaaacagcacattcagatccccaagctctacacctcc
aatgtgacctgggacccgcaccactacaggctcgtgcaggactcacagcctttggacctc
agcaaagccctcagcagcatgcatgccaagaacgtgttcaccatgaggctcaaatctcgg
cagaatctacaaagtccgacatccagccgtgccaccatcctggtggaactctcctgtgag
gatggccaaggcctgaactacctgccgggggagcaccttggggtttgcccaggcaaccag
ccggccctggtccaaggtatcctggagcgagtggtggatggccccacaccccaccagaca
gtgcgcctggaggccctggatgagagtggcagctactgggtcagtgacaagaggctgccc
ccctgctcactcagccaggccctcacctacttcctggacatcaccacacccccaacccag
ctgctgctccaaaagctggcccaggtggccacagaagagcctgagagacagaggctggag
gccctgtgccagccctcagagtacagcaagtggaagttcaccaacagccccacattcctg
gaggtgctagaggagttcccgtccctgcgggtgtctgctggcttcctgctttcccagctc
cccattctgaagcccaggttctactccatcagctcctcccgggatcacacgcccacagag
atccacctgactgtggccgtggtcacctaccacacccgagatggccagggtcccctgcac
cacggcgtctgcagcacatggctcaacagcctgaagccccaagacccagtgccctgcttt
gtgcggaatgccagcggcttccacctccccgaggatccctcccatccttgcatcctcatc
gggcctggcacaggcatcgcgcccttccgcagtttctggcagcaacggctccatgactcc
cagcacaagggagtgcggggaggccgcatgaccttggtgtttgggtgccgccgcccagat
gaggaccacatctaccaggaggagatgctggagatggcccagaagggggtgctgcatgcg
gtgcacacagcctattcccgcctgcctggcaagcccaaggtctatgttcaggacatcctg
cggcagcagctggccagcgaggtgctccgtgtgctccacaaggagccaggccacctctat
gtttgcggggatgtgcgcatggcccgggacgtggcccacaccctgaagcagctggtggct
gccaagctgaaattgaatgaggagcaggtcgaggactatttctttcagctcaagagccag
aagcgctatcacgaagatatctttggtgctgtatttccttacgaggcgaagaaggacagg
gtggcggtgcagcccagcagcctggagatgtcagcgctctga

KEGG   Homo sapiens (human): 4846Help
Entry
4846              CDS       T01001                                 

Gene name
NOS3, ECNOS, eNOS
Definition
(RefSeq) nitric oxide synthase 3
  KO
K13242  nitric-oxide synthase, endothelial [EC:1.14.13.39]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00220  Arginine biosynthesis
hsa00330  Arginine and proline metabolism
hsa01100  Metabolic pathways
hsa04020  Calcium signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04066  HIF-1 signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04370  VEGF signaling pathway
hsa04371  Apelin signaling pathway
hsa04611  Platelet activation
hsa04915  Estrogen signaling pathway
hsa04921  Oxytocin signaling pathway
hsa04926  Relaxin signaling pathway
hsa04931  Insulin resistance
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05418  Fluid shear stress and atherosclerosis
Disease
H01529  Avascular necrosis of femoral head
Drug target
Pimagedine hydrochloride: D05479
Tilarginine acetate: D09018
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    4846 (NOS3)
   00330 Arginine and proline metabolism
    4846 (NOS3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    4846 (NOS3)
   04371 Apelin signaling pathway
    4846 (NOS3)
   04066 HIF-1 signaling pathway
    4846 (NOS3)
   04020 Calcium signaling pathway
    4846 (NOS3)
   04071 Sphingolipid signaling pathway
    4846 (NOS3)
   04022 cGMP-PKG signaling pathway
    4846 (NOS3)
   04151 PI3K-Akt signaling pathway
    4846 (NOS3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    4846 (NOS3)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    4846 (NOS3)
   04921 Oxytocin signaling pathway
    4846 (NOS3)
   04926 Relaxin signaling pathway
    4846 (NOS3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    4846 (NOS3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    4846 (NOS3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    4846 (NOS3)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     4846 (NOS3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 HTH_15
Motif
Other DBs
NCBI-GeneID: 4846
NCBI-ProteinID: NP_000594
OMIM: 163729
HGNC: 7876
Ensembl: ENSG00000164867
Vega: OTTHUMG00000158343
Pharos: P29474(Tchem)
UniProt: P29474
Structure
PDB: 

Position
7q36.1
AA seq 1203 aa AA seqDB search
MGNLKSVAQEPGPPCGLGLGLGLGLCGKQGPATPAPEPSRAPASLLPPAPEHSPPSSPLT
QPPEGPKFPRVKNWEVGSITYDTLSAQAQQDGPCTPRRCLGSLVFPRKLQGRPSPGPPAP
EQLLSQARDFINQYYSSIKRSGSQAHEQRLQEVEAEVAATGTYQLRESELVFGAKQAWRN
APRCVGRIQWGKLQVFDARDCRSAQEMFTYICNHIKYATNRGNLRSAITVFPQRCPGRGD
FRIWNSQLVRYAGYRQQDGSVRGDPANVEITELCIQHGWTPGNGRFDVLPLLLQAPDDPP
ELFLLPPELVLEVPLEHPTLEWFAALGLRWYALPAVSNMLLEIGGLEFPAAPFSGWYMST
EIGTRNLCDPHRYNILEDVAVCMDLDTRTTSSLWKDKAAVEINVAVLHSYQLAKVTIVDH
HAATASFMKHLENEQKARGGCPADWAWIVPPISGSLTPVFHQEMVNYFLSPAFRYQPDPW
KGSAAKGTGITRKKTFKEVANAVKISASLMGTVMAKRVKATILYGSETGRAQSYAQQLGR
LFRKAFDPRVLCMDEYDVVSLEHETLVLVVTSTFGNGDPPENGESFAAALMEMSGPYNSS
PRPEQHKSYKIRFNSISCSDPLVSSWRRKRKESSNTDSAGALGTLRFCVFGLGSRAYPHF
CAFARAVDTRLEELGGERLLQLGQGDELCGQEEAFRGWAQAAFQAACETFCVGEDAKAAA
RDIFSPKRSWKRQRYRLSAQAEGLQLLPGLIHVHRRKMFQATIRSVENLQSSKSTRATIL
VRLDTGGQEGLQYQPGDHIGVCPPNRPGLVEALLSRVEDPPAPTEPVAVEQLEKGSPGGP
PPGWVRDPRLPPCTLRQALTFFLDITSPPSPQLLRLLSTLAEEPREQQELEALSQDPRRY
EEWKWFRCPTLLEVLEQFPSVALPAPLLLTQLPLLQPRYYSVSSAPSTHPGEIHLTVAVL
AYRTQDGLGPLHYGVCSTWLSQLKPGDPVPCFIRGAPSFRLPPDPSLPCILVGPGTGIAP
FRGFWQERLHDIESKGLQPTPMTLVFGCRCSQLDHLYRDEVQNAQQRGVFGRVLTAFSRE
PDNPKTYVQDILRTELAAEVHRVLCLERGHMFVCGDVTMATNVLQTVQRILATEGDMELD
EAGDVIGVLRDQQRYHEDIFGLTLRTQEVTSRIRTQSFSLQERQLRGAVPWAFDPPGSDT
NSP
NT seq 3612 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacttgaagagcgtggcccaggagcctgggccaccctgcggcctggggctgggg
ctgggccttgggctgtgcggcaagcagggcccagccaccccggcccctgagcccagccgg
gccccagcatccctactcccaccagcgccagaacacagccccccgagctccccgctaacc
cagcccccagaggggcccaagttccctcgtgtgaagaactgggaggtggggagcatcacc
tatgacaccctcagcgcccaggcgcagcaggatgggccctgcaccccaagacgctgcctg
ggctccctggtatttccacggaaactacagggccggccctcccccggccccccggcccct
gagcagctgctgagtcaggcccgggacttcatcaaccagtactacagctccattaagagg
agcggctcccaggcccacgaacagcggcttcaagaggtggaagccgaggtggcagccaca
ggcacctaccagcttagggagagcgagctggtgttcggggctaagcaggcctggcgcaac
gctccccgctgcgtgggccggatccagtgggggaagctgcaggtgttcgatgcccgggac
tgcaggtctgcacaggaaatgttcacctacatctgcaaccacatcaagtatgccaccaac
cggggcaaccttcgctcggccatcacagtgttcccgcagcgctgccctggccgaggagac
ttccgaatctggaacagccagctggtgcgctacgcgggctaccggcagcaggatggctct
gtgcggggggacccagccaacgtggagatcaccgagctctgcattcagcacggctggacc
ccaggaaacggtcgcttcgacgtgctgcccctgctgctgcaggccccagatgatccccca
gaactcttccttctgccccccgagctggtccttgaggtgcccctggagcaccccacgctg
gagtggtttgcagccctgggcctgcgctggtacgccctcccggcagtgtccaacatgctg
ctggaaattgggggcctggagttccccgcagcccccttcagtggctggtacatgagcact
gagatcggcacgaggaacctgtgtgaccctcaccgctacaacatcctggaggatgtggct
gtctgcatggacctggatacccggaccacctcgtccctgtggaaagacaaggcagcagtg
gaaatcaacgtggccgtgctgcacagttaccagctagccaaagtcaccatcgtggaccac
cacgccgccacggcctctttcatgaagcacctggagaatgagcagaaggccagggggggc
tgccctgcagactgggcctggatcgtgccccccatctcgggcagcctcactcctgttttc
catcaggagatggtcaactatttcctgtccccggccttccgctaccagccagacccctgg
aaggggagtgccgccaagggcaccggcatcaccaggaagaagacctttaaagaagtggcc
aacgccgtgaagatctccgcctcgctcatgggcacggtgatggcgaagcgagtgaaggcg
acaatcctgtatggctccgagaccggccgggcccagagctacgcacagcagctggggaga
ctcttccggaaggcttttgatccccgggtcctgtgtatggatgagtatgacgtggtgtcc
ctcgaacacgagacgctggtgctggtggtaaccagcacatttgggaatggggatcccccg
gagaatggagagagctttgcagctgccctgatggagatgtccggcccctacaacagctcc
cctcggccggaacagcacaagagttataagatccgcttcaacagcatctcctgctcagac
ccactggtgtcctcttggcggcggaagaggaaggagtccagtaacacagacagtgcaggg
gccctgggcaccctcaggttctgtgtgttcgggctcggctcccgggcatacccccacttc
tgcgcctttgctcgtgccgtggacacacggctggaggaactgggcggggagcggctgctg
cagctgggccagggcgacgagctgtgcggccaggaggaggccttccgaggctgggcccag
gctgccttccaggccgcctgtgagaccttctgtgtgggagaggatgccaaggccgccgcc
cgagacatcttcagccccaaacggagctggaagcgccagaggtaccggctgagcgcccag
gccgagggcctgcagttgctgccaggtctgatccacgtgcacaggcggaagatgttccag
gctacaatccgctcagtggaaaacctgcaaagcagcaagtccacgagggccaccatcctg
gtgcgcctggacaccggaggccaggaggggctgcagtaccagccgggggaccacataggt
gtctgcccgcccaaccggcccggccttgtggaggcgctgctgagccgcgtggaggacccg
ccggcgcccactgagcccgtggcagtagagcagctggagaagggcagccctggtggccct
ccccccggctgggtgcgggacccccggctgcccccgtgcacgctgcgccaggctctcacc
ttcttcctggacatcacctccccacccagccctcagctcttgcggctgctcagcaccttg
gcagaagagcccagggaacagcaggagctggaggccctcagccaggatccccgacgctac
gaggagtggaagtggttccgctgccccacgctgctggaggtgctggagcagttcccgtcg
gtggcgctgcctgccccactgctcctcacccagctgcctctgctccagccccggtactac
tcagtcagctcggcacccagcacccacccaggagagatccacctcactgtagctgtgctg
gcatacaggactcaggatgggctgggccccctgcactatggagtctgctccacgtggcta
agccagctcaagcccggagaccctgtgccctgcttcatccggggggctccctccttccgg
ctgccacccgatcccagcttgccctgcatcctggtgggtccaggcactggcattgccccc
ttccggggattctggcaggagcggctgcatgacattgagagcaaagggctgcagcccact
cccatgactttggtgttcggctgccgatgctcccaacttgaccatctctaccgcgacgag
gtgcagaacgcccagcagcgcggggtgtttggccgagtcctcaccgccttctcccgggaa
cctgacaaccccaagacctacgtgcaggacatcctgaggacggagctggctgcggaggtg
caccgcgtgctgtgcctcgagcggggccacatgtttgtctgcggcgatgttaccatggca
accaacgtcctgcagaccgtgcagcgcatcctggcgacggagggcgacatggagctggac
gaggccggcgacgtcatcggcgtgctgcgggatcagcaacgctaccacgaagacattttc
gggctcacgctgcgcacccaggaggtgacaagccgcatacgcacccagagcttttccttg
caggagcgtcagttgcggggcgcagtgccctgggcgttcgaccctcccggctcagacacc
aacagcccctga

DBGET integrated database retrieval system