KEGG   Homo sapiens (human): 4849
Entry
4849              CDS       T01001                                 
Symbol
CNOT3, IDDSADF, LENG2, NOT3, NOT3H
Name
(RefSeq) CCR4-NOT transcription complex subunit 3
  KO
K12580  CCR4-NOT transcription complex subunit 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa03018  RNA degradation
Disease
H02371  Intellectual developmental disorder with autism and speech delay
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4849 (CNOT3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    4849 (CNOT3)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     4849 (CNOT3)
  mRNA degradation factors
   3'-5' decay
    Ccr4-NOT complex
     4849 (CNOT3)
SSDB
Motif
Pfam: Not3 NOT2_3_5
Other DBs
NCBI-GeneID: 4849
NCBI-ProteinID: NP_055331
OMIM: 604910
HGNC: 7879
Ensembl: ENSG00000088038
Pharos: O75175(Tbio)
UniProt: O75175 A0A024R4R3
Structure
Position
19:54137762..54155681
AA seq 753 aa
MADKRKLQGEIDRCLKKVSEGVEQFEDIWQKLHNAANANQKEKYEADLKKEIKKLQRLRD
QIKTWVASNEIKDKRQLIDNRKLIETQMERFKVVERETKTKAYSKEGLGLAQKVDPAQKE
KEEVGQWLTNTIDTLNMQVDQFESEVESLSVQTRKKKGDKDKQDRIEGLKRHIEKHRYHV
RMLETILRMLDNDSILVDAIRKIKDDVEYYVDSSQDPDFEENEFLYDDLDLEDIPQALVA
TSPPSHSHMEDEIFNQSSSTPTSTTSSSPIPPSPANCTTENSEDDKKRGRSTDSEVSQSP
AKNGSKPVHSNQHPQSPAVPPTYPSGPPPAASALSTTPGNNGVPAPAAPPSALGPKASPA
PSHNSGTPAPYAQAVAPPAPSGPSTTQPRPPSVQPSGGGGGGSGGGGSSSSSNSSAGGGA
GKQNGATSYSSVVADSPAEVALSSSGGNNASSQALGPPSGPHNPPPSTSKEPSAAAPTGA
GGVAPGSGNNSGGPSLLVPLPVNPPSSPTPSFSDAKAAGALLNGPPQFSTAPEIKAPEPL
SSLKSMAERAAISSGIEDPVPTLHLTERDIILSSTSAPPASAQPPLQLSEVNIPLSLGVC
PLGPVPLTKEQLYQQAMEEAAWHHMPHPSDSERIRQYLPRNPCPTPPYHHQMPPPHSDTV
EFYQRLSTETLFFIFYYLEGTKAQYLAAKALKKQSWRFHTKYMMWFQRHEEPKTITDEFE
QGTYIYFDYEKWGQRKKEGFTFEYRYLEDRDLQ
NT seq 2262 nt   +upstreamnt  +downstreamnt
atggcggacaagcgcaaactccaaggtgagattgatcgctgcctcaagaaggtgtccgag
ggcgtggagcagtttgaagatatttggcagaagctccacaatgcagccaacgcgaaccag
aaagaaaagtatgaggctgacctaaagaaggagattaagaagctacaacggctgagggac
caaatcaagacatgggtagcgtccaacgagatcaaggacaagaggcagcttatagacaac
cgcaagctcattgagacgcaaatggaacggttcaaagttgtggaacgagagaccaaaacc
aaagcttacagcaaagagggcctgggcctggcccagaaggtagatcctgcccagaaggag
aaggaagaggttggccagtggctcacgaataccatcgacacgctcaacatgcaggtggac
cagtttgagagtgaagtggagtcactgtcagtgcagacacgcaagaagaagggcgacaag
gataagcaggaccggattgagggcttgaagcggcacatcgagaagcaccgctaccacgtg
cgcatgctagagaccatcctgcgcatgctggacaatgactccatcctcgttgacgccatc
cgcaagatcaaggacgacgttgagtactatgttgactcatcccaggaccccgacttcgag
gagaacgagtttctctacgatgacctggacctcgaggacattccacaggcgctggtcgcc
acctccccccccagccacagccacatggaggatgagatcttcaaccagtccagcagcacg
cccacctcaaccacctccagctctcccatcccgcccagcccagccaactgtaccacggaa
aactctgaagatgataagaagaggggacgttccacagacagtgaagtcagccagtctcca
gccaaaaacggctccaagcctgtccacagcaaccagcaccctcagtccccagctgtgccg
cccacctacccctccggccccccgcctgctgcctctgccttgagcaccactcctggcaac
aatggggtccccgcccccgcagcacccccaagtgccctgggccccaaggccagtccagct
cccagccacaactcgggcacccctgctccctatgcccaggctgtggccccaccagctccc
agtgggcccagcacgacccagccccggccccccagcgtccagcctagcggaggcggaggc
ggcggcagcggaggcggagggagcagcagcagtagtaacagcagtgccggtggaggggct
ggcaagcagaatggcgccaccagttacagctcagttgtggcagacagcccggcagaggtg
gctttgagcagcagtgggggcaacaatgccagcagccaggccttgggccccccttccggc
ccccacaacccacctcccagcacctcgaaggaacccagtgcggcagccccaacgggggct
gggggcgtggccccaggctcagggaacaactcagggggacccagcctcctggtgccactg
cctgtgaatcctcccagctccccaacgcccagcttcagtgatgccaaggcagccggtgcc
ctgctcaatgggcctccacagttcagcaccgccccagaaatcaaggcccctgagcctctg
agctccttgaagtccatggcggaacgggcagccatcagctctggcattgaggaccctgtg
ccaacgctgcacctgaccgagcgagacatcatcctgagcagtacatcagcacctccggcc
tcagcccagccgcccctgcagctgtcagaggtgaacataccgctgtcgctgggtgtctgt
ccactgggccctgtgcccctcaccaaggagcagctctatcagcaggccatggaagaggcc
gcctggcaccacatgcctcacccctctgactctgagcgtattcggcagtacctcccccgg
aacccctgtccgacgcccccctaccaccaccagatgccacccccacactcggacactgtg
gaattctaccagcgcctgtcgaccgagacactcttcttcatcttctactatctggagggc
actaaggcacagtatctggcagccaaggccctaaagaagcagtcatggcgattccacacc
aagtacatgatgtggttccagaggcacgaggagcccaagaccatcactgacgagtttgag
cagggcacctacatctactttgactacgagaagtggggccagcggaagaaggaaggcttc
acctttgagtaccgctacctggaggaccgggacctccagtga

DBGET integrated database retrieval system