KEGG   Homo sapiens (human): 4852Help
Entry
4852              CDS       T01001                                 

Gene name
NPY, PYY4
Definition
(RefSeq) neuropeptide Y
  KO
K05232  neuropeptide Y
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa04923  Regulation of lipolysis in adipocytes
hsa05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    4852 (NPY)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    4852 (NPY)
   04920 Adipocytokine signaling pathway
    4852 (NPY)
 09160 Human Diseases
  09165 Substance dependence
   05034 Alcoholism
    4852 (NPY)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hormone_3
Motif
Other DBs
NCBI-GeneID: 4852
NCBI-ProteinID: NP_000896
OMIM: 162640
HGNC: 7955
Ensembl: ENSG00000122585
Vega: OTTHUMG00000022973
Pharos: P01303(Tbio)
CPD: C15949
UniProt: P01303 A4D158
Structure
PDB: 

Position
7p15.3
AA seq 97 aa AA seqDB search
MLGNKRLGLSGLTLALSLLVCLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLIT
RQRYGKRSSPETLISDLLMRESTENVPRTRLEDPAMW
NT seq 294 nt NT seq  +upstreamnt  +downstreamnt
atgctaggtaacaagcgactggggctgtccggactgaccctcgccctgtccctgctcgtg
tgcctgggtgcgctggccgaggcgtacccctccaagccggacaacccgggcgaggacgca
ccagcggaggacatggccagatactactcggcgctgcgacactacatcaacctcatcacc
aggcagagatatggaaaacgatccagcccagagacactgatttcagacctcttgatgaga
gaaagcacagaaaatgttcccagaactcggcttgaagaccctgcaatgtggtga

DBGET integrated database retrieval system