KEGG   Homo sapiens (human): 486Help
Entry
486               CDS       T01001                                 

Gene name
FXYD2, ATP1G1, HOMG2
Definition
(RefSeq) FXYD domain containing ion transport regulator 2
  KO
K01538  sodium/potassium-transporting ATPase subunit gamma (FXYD domain-containing ion transport regulator 2)
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04260  Cardiac muscle contraction
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04911  Insulin secretion
hsa04918  Thyroid hormone synthesis
hsa04919  Thyroid hormone signaling pathway
hsa04960  Aldosterone-regulated sodium reabsorption
hsa04961  Endocrine and other factor-regulated calcium reabsorption
hsa04964  Proximal tubule bicarbonate reclamation
hsa04970  Salivary secretion
hsa04972  Pancreatic secretion
hsa04973  Carbohydrate digestion and absorption
hsa04974  Protein digestion and absorption
hsa04976  Bile secretion
hsa04978  Mineral absorption
Disease
H01210  Hypomagnesemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    486 (FXYD2)
   04022 cGMP-PKG signaling pathway
    486 (FXYD2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    486 (FXYD2)
   04918 Thyroid hormone synthesis
    486 (FXYD2)
   04919 Thyroid hormone signaling pathway
    486 (FXYD2)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    486 (FXYD2)
   04261 Adrenergic signaling in cardiomyocytes
    486 (FXYD2)
  09154 Digestive system
   04970 Salivary secretion
    486 (FXYD2)
   04972 Pancreatic secretion
    486 (FXYD2)
   04976 Bile secretion
    486 (FXYD2)
   04973 Carbohydrate digestion and absorption
    486 (FXYD2)
   04974 Protein digestion and absorption
    486 (FXYD2)
   04978 Mineral absorption
    486 (FXYD2)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    486 (FXYD2)
   04961 Endocrine and other factor-regulated calcium reabsorption
    486 (FXYD2)
   04964 Proximal tubule bicarbonate reclamation
    486 (FXYD2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    486 (FXYD2)
   04147 Exosome [BR:hsa04147]
    486 (FXYD2)
Transporters [BR:hsa02000]
 Other Transporters
  Pores ion channels [TC:1]
   486 (FXYD2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   486 (FXYD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP1G1_PLM_MAT8 Nitrate_red_gam
Motif
Other DBs
NCBI-GeneID: 486
NCBI-ProteinID: NP_001671
OMIM: 601814
HGNC: 4026
Ensembl: ENSG00000137731
Vega: OTTHUMG00000166990
Pharos: P54710(Tclin)
UniProt: P54710
Structure
PDB: 

Position
11q23.3
AA seq 66 aa AA seqDB search
MTGLSMDGGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQ
INEDEP
NT seq 201 nt NT seq  +upstreamnt  +downstreamnt
atgactgggttgtcgatggacggtggcggcagccccaagggggacgtggacccgttctac
tatgactatgagaccgttcgcaatgggggcctgatcttcgctggactggccttcatcgtg
gggctcctcatcctcctcagcagaagattccgctgtgggggcaataagaagcgcaggcaa
atcaatgaagatgagccgtaa

DBGET integrated database retrieval system