KEGG   Homo sapiens (human): 4862Help
Entry
4862              CDS       T01001                                 

Gene name
NPAS2, MOP4, PASD4, bHLHe9
Definition
(RefSeq) neuronal PAS domain protein 2
  KO
K09026  neuronal PAS domain-containing protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04710  Circadian rhythm
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Environmental adaptation
   04710 Circadian rhythm
    4862 (NPAS2)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    4862 (NPAS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAS_11 PAS_3 PAS HLH PAS_9
Motif
Other DBs
NCBI-GeneID: 4862
NCBI-ProteinID: NP_002509
OMIM: 603347
HGNC: 7895
Ensembl: ENSG00000170485
Vega: OTTHUMG00000130675
Pharos: Q99743(Tbio)
UniProt: Q99743 A2I2P5
Position
2q11.2
AA seq 824 aa AA seqDB search
MDEDEKDRAKRASRNKSEKKRRDQFNVLIKELSSMLPGNTRKMDKTTVLEKVIGFLQKHN
EVSAQTEICDIQQDWKPSFLSNEEFTQLMLEALDGFIIAVTTDGSIIYVSDSITPLLGHL
PSDVMDQNLLNFLPEQEHSEVYKILSSHMLVTDSPSPEYLKSDSDLEFYCHLLRGSLNPK
EFPTYEYIKFVGNFRSYNNVPSPSCNGFDNTLSRPCRVPLGKEVCFIATVRLATPQFLKE
MCIVDEPLEEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSGYDYYHIDDLELLARCH
QHLMQFGKGKSCCYRFLTKGQQWIWLQTHYYITYHQWNSKPEFIVCTHSVVSYADVRVER
RQELALEDPPSEALHSSALKDKGSSLEPRQHFNTLDVGASGLNTSHSPSASSRSSHKSSH
TAMSEPTSTPTKLMAEASTPALPRSATLPQELPVPGLSQAATMPAPLPSPSSCDLTQQLL
PQTVLQSTPAPMAQFSAQFSMFQTIKDQLEQRTRILQANIRWQQEELHKIQEQLCLVQDS
NVQMFLQQPAVSLSFSSTQRPEAQQQLQQRSAAVTQPQLGAGPQLPGQISSAQVTSQHLL
RESSVISTQGPKPMRSSQLMQSSGRSGSSLVSPFSSATAALPPSLNLTTPASTSQDASQC
QPSPDFSHDRQLRLLLSQPIQPMMPGSCDARQPSEVSRTGRQVKYAQSQTVFQNPDAHPA
NSSSAPMPVLLMGQAVLHPSFPASQPSPLQPAQARQQPPQHYLQVQAPTSLHSEQQDSLL
LSTYSQQPGTLGYPQPPPAQPQPLRPPRRVSSLSESSGLQQPPR
NT seq 2475 nt NT seq  +upstreamnt  +downstreamnt
atggatgaagatgagaaagacagagccaagagagcttctcgaaacaagtctgagaagaag
cgtcgggaccagttcaatgttctcatcaaagagctcagttccatgctccctggcaacacg
cggaaaatggacaaaaccaccgtgttggaaaaggtcatcggatttttgcagaaacacaat
gaagtctcagcgcaaacggaaatctgtgacattcagcaagactggaagccttcattcctc
agtaatgaagaattcacccagctgatgttggaggcattagatggcttcattatcgcagtg
acaacagacggcagcatcatctatgtctctgacagtatcacgcctctccttgggcattta
ccgtcggatgtcatggatcagaatttgttaaatttcctcccagaacaagaacattcagaa
gtttataaaatcctttcttcccatatgcttgtgacggattccccctccccagaatactta
aaatctgacagcgatttagagttttattgccatcttctcagaggcagcttgaacccaaag
gaatttccaacttatgaatacataaaatttgtaggaaattttcgctcttacaacaatgtg
cctagcccctcctgtaatggttttgacaacaccctttcaagaccttgccgggtgccacta
ggaaaggaggtttgcttcattgccaccgttcgtctggcaacaccacaattcttaaaggaa
atgtgcatagttgacgaacctttagaggaattcacttcaaggcatagcttggaatggaaa
tttttatttctggatcacagagcacctccaatcataggatacctgccttttgaagtgctg
ggaacctcaggctatgactactaccacattgatgacctggagctcctggccaggtgtcac
cagcacctgatgcagtttggcaaagggaagtcgtgttgctaccggtttctgaccaaaggt
cagcagtggatctggctgcagactcactactacatcacctaccatcagtggaactccaag
cccgagttcatcgtgtgcacacactcggtggtcagttacgcagatgtccgggtggaaagg
aggcaggagctggctctggaagacccgccatccgaggccctccactcctcagcactaaag
gacaagggctcaagcctggaacctcggcagcactttaacacactcgacgtgggtgcctcg
ggccttaataccagtcattcgccatcggcgtcctcaagaagttcccacaaatcctcgcac
acagccatgtcagaacccacctccactcccaccaagctgatggcagaggccagcaccccg
gctttgccaagatcagccaccctgccccaagagttacctgtccccgggctcagccaggca
gccaccatgccggcccctctgccttccccatcgtcctgcgacctcacacagcagctcctg
cctcagaccgttctgcagagcacgcccgctcccatggcacagttttcggcacagttcagc
atgttccagaccatcaaagaccagctagagcagcggacgcggatcctgcaggccaatatc
cggtggcaacaggaagagctccacaagatccaggagcagctctgcctggtccaggactcc
aacgtccagatgttcctgcagcagccagctgtatccctgagcttcagcagcacccagcga
cctgaggctcagcagcagctacagcaaaggtcagctgcagtgactcagccccagctcggg
gcgggcccccaacttccagggcagatctcctctgcccaggtcacaagccagcacctgctc
agagaatcaagtgtgatatcaacccagggtccaaagccaatgagaagctcacagctaatg
cagagcagcggccgctctggaagcagcctagtgtccccgttcagcagcgccacagctgcg
ctcccgccaagtctgaatctgaccacacctgcttccacctcccaggatgccagccagtgc
cagcccagcccagacttcagccatgatcggcagctcaggctgttgctgagccagcccatc
cagcccatgatgcccgggtcctgtgacgcaaggcagccctcggaagtcagcaggacggga
cggcaagtcaagtacgcccagagccagaccgtgtttcaaaatccagacgcacaccccgcc
aacagcagcagcgccccgatgcccgtcctgctgatggggcaggcggtgctccaccccagc
ttccctgcctcccaaccatcgcccctgcagcctgcacaggcccggcagcagccaccgcag
cactacctgcaggtacaggcaccaacctctttgcacagtgagcagcaggactcgctactt
ctctccacctactcacaacagccagggaccctgggctacccccaaccacccccagcacag
ccccagcccctacgtcctccccgaagggtcagcagtctgtctgagtcgtcaggcctccag
cagccgccccgataa

DBGET integrated database retrieval system