KEGG   Homo sapiens (human): 4863Help
Entry
4863              CDS       T01001                                 

Gene name
NPAT, E14, E14/NPAT, p220
Definition
(RefSeq) nuclear protein, coactivator of histone transcription
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: NPAT_C LisH_TPL
Motif
Other DBs
NCBI-GeneID: 4863
NCBI-ProteinID: NP_002510
OMIM: 601448
HGNC: 7896
Ensembl: ENSG00000149308
Vega: OTTHUMG00000166385
Pharos: Q14207(Tbio)
UniProt: Q14207
Position
11q22.3
AA seq 1427 aa AA seqDB search
MLLPSDVARLVLGYLQQENLISTCQTFILESSDLKEYAEHCTDEGFIPACLLSLFGKNLT
TILNEYVAMKTKETSNNVPAIMSSLWKKLDHTLSQIRSMQSSPRFAGSQRARTRTGIAEI
KRQRKLASQTAPASAELLTLPYLSGQFTTPPSTGTQVTRPSGQISDPSRSYFVVVNHSQS
QDTVTTGEALNVIPGAQEKKAHASLMSPGRRKSESQRKSTTLSGPHSTIRNFQDPNAFAV
EKQMVIENAREKILSNKSLQEKLAENINKFLTSDNNIAQVPKQTDNNPTEPETSIDEFLG
LPSEIHMSEEAIQDILEQTESDPAFQALFDLFDYGKTKNNKNISQSISSQPMESNPSIVL
ADETNLAVKGSFETEESDGQSGQPAFCTSYQNDDPLNALKNSNNHDVLRQEDQENFSQIS
TSIQKKAFKTAVPTEQKCDIDITFESVPNLNDFNQRGNSNAECNPHCAELYTNQMSTETE
MAIGIEKNSLSSNVPSESQLQPDQPDIPITSFVSLGCEANNENLILSGKSSQLLSQDTSL
TGKPSKKSQFCENSNDTVKLKINFHGSKSSDSSEVHKSKIEINVLEPVMSQLSNCQDNSC
LQSEILPVSVESSHLNVSGQVEIHLGDSLSSTKQPSNDSASVELNHTENEAQASKSENSQ
EPSSSVKEENTIFLSLGGNANCEKVALTPPEGTPVENSHSLPPESVCSSVGDSHPESQNT
DDKPSSNNSAEIDASNIVSLKVIISDDPFVSSDTELTSAVSSINGENLPTIILSSPTKSP
TKNAELVKCLSSEETVGAVVYAEVGDSASMEQSLLTFKSEDSAVNNTQNEDGIAFSANVT
PCVSKDGGYIQLMPATSTAFGNSNNILIATCVTDPTALGTSVSQSNVVVLPGNSAPMTAQ
PLPPQLQTPPRSNSVFAVNQAVSPNFSQGSAIIIASPVQPVLQGMVGMIPVSVVGQNGNN
FSTPPRQVLHMPLTAPVCNRSIPQFPVPPKSQKAQGLRNKPCIGKQVNNLVDSSGHSVGC
HAQKTEVSDKSIATDLGKKSEETTVPFPEESIVPAAKPCHRRVLCFDSTTAPVANTQGPN
HKMVSQNKERNAVSFPNLDSPNVSSTLKPPSNNAIKREKEKPPLPKILSKSESAISRHTT
IRETQSEKKVSPTEIVLESFHKATANKENELCSDVERQKNPENSKLSIGQQNGGLRSEKS
IASLQEMTKKQGTSSNNKNVLSVGTAVKDLKQEQTKSASSLITTEMLQDIQRHSSVSRLA
DSSDLPVPRTPGSGAGEKHKEEPIDIIKAPSSRRFSEDSSTSKVMVPPVTPDLPACSPAS
ETGSENSVNMAAHTLMILSRAAISRTTSATPLKDNTQQFRASSRSTTKKRKIEELDERER
NSRPSSKNLTNSSIPMKKKKIKKKKLPSSFPAGMDVDKFLLSLHYDE
NT seq 4284 nt NT seq  +upstreamnt  +downstreamnt
atgttgttaccctcggacgtagcccggcttgtattgggttacttacagcaagaaaacctc
atttctacctgccagacttttattttggaaagttcagatttaaaagaatatgcagaacat
tgtacagatgaagggtttattccagcctgcttactgtccttatttggaaaaaacttgaca
acaattttaaatgagtatgtagctatgaaaacaaaagaaacatcaaataatgtcccagca
ataatgtcatctctatggaagaaattggaccatacactttctcagatcaggagcatgcaa
agttccccaaggtttgctggcagtcagagagcccgaacgagaactggaattgcagaaatc
aaacggcagagaaagcttgcatctcaaacagctccagccagtgcagagttgctcacttta
ccttacctttcaggacagtttaccactcctccttccacaggtacacaggttactcgacca
agtggccaaatttcagatccatcgaggtcatattttgtagtggtcaaccactcacagtca
caagatactgtaaccactggagaagctttaaatgtcattcctggtgctcaggaaaagaaa
gcacatgccagtttaatgtctcccggtagacgcaaaagtgaatctcagagaaaaagtacc
actttgtctggccctcattcaacaatacggaatttccaagatccaaacgcttttgcagta
gaaaaacaaatggttattgaaaatgcacgagaaaaaatactaagcaacaaatctcttcaa
gaaaagctagcagaaaacataaataaatttttaactagtgataacaatattgcccaagta
cctaagcaaacagataacaaccctacggagccagagacttcaattgatgaattcctagga
cttccgagtgaaattcacatgtctgaagaagctatacaggacatattggaacagacagaa
tcagacccagcatttcaggcactctttgatctctttgactatggcaaaacaaagaataat
aaaaatatatcacaaagtatttccagtcaacctatggaatccaatcccagtatagtctta
gcagatgaaactaatctagcagttaaaggttcttttgaaacagaagaatctgatggtcag
tctggtcagcccgctttttgtacatcctatcagaatgatgacccattaaatgctttgaag
aatagcaacaaccatgatgtgcttagacaagaagaccaggaaaatttttcccaaataagt
accagcatacagaaaaaggcctttaaaacagctgtacccactgaacagaagtgtgacatt
gacattacctttgagtccgtgcctaatttgaatgactttaaccaaagagggaattctaat
gctgaatgtaatccacattgtgctgaattatacaccaatcagatgtccactgaaactgaa
atggctatagggattgaaaagaactctttgtcttcaaatgtaccgagtgaatctcagtta
cagcctgatcagcctgatataccaataacttcatttgtttcacttggttgtgaagctaac
aatgaaaacttaattctctctgggaagagttctcaacttttatcccaagatacttcatta
actggaaagccatctaaaaaaagtcaattttgtgaaaattctaatgatacagtaaaactt
aaaattaattttcatggttccaagtcatcagattctagtgaagttcacaagagtaaaata
gaaattaatgtgttagaaccagttatgtcacagctatcaaattgccaagataattcttgt
cttcaaagtgaaatactacctgtgtctgttgaaagttcacatttaaatgtatctggacaa
gtagaaattcatcttggagattcgctgtcttctactaaacaaccatctaatgattcagca
tctgttgagttaaatcatacagaaaatgaagctcaggcatccaagtctgagaattcacag
gagccttcatcttctgtaaaagaagagaatactatttttctctctttaggtggaaatgct
aactgtgagaaagttgcactgacgcctccagaaggcactcctgtagaaaacagtcactct
cttcctccagaatctgtgtgttcttcagtgggagattctcaccctgagtcccaaaatact
gatgataaaccttctagcaacaactcagcagagatagatgcatcaaatatcgtctctctc
aaagttatcattagtgatgatccatttgtttcctcagatactgaacttaccagtgctgtt
tctagtattaatggagaaaacctgccaactataatcttgtcttctcctactaaatcacct
actaaaaatgcagaactagttaaatgcctatcttcagaagaaactgtaggtgctgttgta
tatgccgaagtaggggattcagcctcaatggaacagagtcttttaacattcaaatctgaa
gactctgcagtaaacaatactcagaatgaagatggcattgctttttcagctaatgttaca
ccatgtgtttccaaggatggaggatatatacagttgatgccagccacaagcacagctttt
ggcaattcaaataacattctgatagctacctgtgtgactgatccaacagcgttaggaaca
tctgtaagtcagtctaatgtagtggtgttgcctggaaattctgcacctatgactgctcaa
cctctaccacctcagttacagacaccaccaaggtcaaacagtgtatttgctgtcaaccaa
gctgtgtcaccaaacttttcacaaggatctgccataataattgcctctccagtccagcct
gtactccaaggaatggtagggatgatcccagtatctgtggttggacagaatggaaataac
ttttctactcctcctcggcaggttcttcatatgcctttgacagcacctgtatgcaataga
agtatccctcaattccccgtccctccaaaatctcagaaggctcagggactaagaaacaag
ccttgtataggaaaacaagtaaataatttggtggattcgtcaggtcattcagttggatgt
catgcacaaaaaactgaagtttctgacaaaagtattgccacagatcttgggaaaaaatca
gaagaaaccacagttcccttcccagaagagagtatagttccagctgctaaaccatgccac
agacgtgtactctgtttcgacagcactactgctcctgtggcaaatacgcaggggccaaac
cataagatggtgtcccaaaacaaagaaaggaatgcagtctcttttcctaatcttgactca
cccaatgtgtcctccaccttaaaacccccttctaataatgctatcaaaagagagaaagag
aagcctcctctgcctaagattttatctaaatcggaaagtgccattagccggcataccacc
ataagagaaactcaatcagaaaagaaagtttcaccaacagaaattgtgcttgaatctttc
cataaagcaacagctaataaggagaatgaattatgcagcgatgtagaaagacagaaaaat
ccagaaaattcaaaactatctattgggcagcaaaatgggggtttgcgaagtgagaaatct
atagcttcactgcaagaaatgaccaaaaaacaaggcacatcttcaaacaataaaaatgta
ctttcagtaggtacagctgtgaaggatctaaaacaagaacaaactaaatccgccagttct
ttgattaccacagaaatgttacaggatatacagaggcacagctcagtaagtaggcttgct
gatagtagtgatttacctgtgccccggacacctggctcaggggcaggggaaaaacataaa
gaagaacctatagatattatcaaggccccctctagtaggcgtttcagtgaagacagtagt
acatcaaaagtaatggtccctcctgtcaccccagacttgcctgcctgcagccctgccagt
gaaacaggaagtgaaaacagtgtaaatatggctgcccacacattaatgattctctccagg
gcagccatttctaggactacttcagcaactcctctgaaagataacacacaacagtttaga
gcatcttcaaggagcaccacaaaaaagcggaaaattgaggaattagatgaacgtgagcga
aactctcgtccttctagtaaaaatcttacaaattcatcaataccaatgaaaaagaagaaa
attaagaaaaagaagcttcccagttcatttccagcaggaatggatgtagacaaatttttg
ttatcattgcattatgatgagtaa

DBGET integrated database retrieval system