KEGG   Homo sapiens (human): 4879
Entry
4879              CDS       T01001                                 

Gene name
NPPB, BNP
Definition
(RefSeq) natriuretic peptide B
  KO
K12335  natriuretic peptide B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04714  Thermogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    4879 (NPPB)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    4879 (NPPB)
  09159 Environmental adaptation
   04714 Thermogenesis
    4879 (NPPB)
SSDB
Motif
Pfam: ANP
Other DBs
NCBI-GeneID: 4879
NCBI-ProteinID: NP_002512
OMIM: 600295
HGNC: 7940
Ensembl: ENSG00000120937
Vega: OTTHUMG00000002389
Pharos: P16860(Tbio)
CPD: C16004
UniProt: P16860
Structure
PDB: 
3N56

Position
1p36.22
AA seq 134 aa
MDPQTAPSRALLLLLFLHLAFLGGRSHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVE
QTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRI
SSSSGLGCKVLRRH
NT seq 405 nt   +upstreamnt  +downstreamnt
atggatccccagacagcaccttcccgggcgctcctgctcctgctcttcttgcatctggct
ttcctgggaggtcgttcccacccgctgggcagccccggttcagcctcggacttggaaacg
tccgggttacaggagcagcgcaaccatttgcagggcaaactgtcggagctgcaggtggag
cagacatccctggagcccctccaggagagcccccgtcccacaggtgtctggaagtcccgg
gaggtagccaccgagggcatccgtgggcaccgcaaaatggtcctctacaccctgcgggca
ccacgaagccccaagatggtgcaagggtctggctgctttgggaggaagatggaccggatc
agctcctccagtggcctgggctgcaaagtgctgaggcggcattaa

DBGET integrated database retrieval system