KEGG   Homo sapiens (human): 4879Help
Entry
4879              CDS       T01001                                 

Gene name
NPPB, BNP
Definition
(RefSeq) natriuretic peptide B
  KO
K12335  natriuretic peptide B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04714  Thermogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    4879 (NPPB)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    4879 (NPPB)
  09159 Environmental adaptation
   04714 Thermogenesis
    4879 (NPPB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANP
Motif
Other DBs
NCBI-GeneID: 4879
NCBI-ProteinID: NP_002512
OMIM: 600295
HGNC: 7940
Ensembl: ENSG00000120937
Vega: OTTHUMG00000002389
Pharos: P16860(Tbio)
CPD: C16004
UniProt: P16860
Structure
PDB: 

Position
1p36.22
AA seq 134 aa AA seqDB search
MDPQTAPSRALLLLLFLHLAFLGGRSHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVE
QTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRI
SSSSGLGCKVLRRH
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atggatccccagacagcaccttcccgggcgctcctgctcctgctcttcttgcatctggct
ttcctgggaggtcgttcccacccgctgggcagccccggttcagcctcggacttggaaacg
tccgggttacaggagcagcgcaaccatttgcagggcaaactgtcggagctgcaggtggag
cagacatccctggagcccctccaggagagcccccgtcccacaggtgtctggaagtcccgg
gaggtagccaccgagggcatccgtgggcaccgcaaaatggtcctctacaccctgcgggca
ccacgaagccccaagatggtgcaagggtctggctgctttgggaggaagatggaccggatc
agctcctccagtggcctgggctgcaaagtgctgaggcggcattaa

DBGET integrated database retrieval system