KEGG   Homo sapiens (human): 4880Help
Entry
4880              CDS       T01001                                 

Gene name
NPPC, CNP, CNP2
Definition
(RefSeq) natriuretic peptide C
  KO
K12336  natriuretic peptide C
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    4880 (NPPC)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    4880 (NPPC)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    4880 (NPPC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANP
Motif
Other DBs
NCBI-GeneID: 4880
NCBI-ProteinID: NP_077720
OMIM: 600296
HGNC: 7941
Ensembl: ENSG00000163273
Vega: OTTHUMG00000133232
Pharos: P23582(Tbio)
CPD: C16005
UniProt: P23582 E5LCN7
Structure
PDB: 

Position
2q37.1
AA seq 126 aa AA seqDB search
MHLSQLLACALLLTLLSLRPSEAKPGAPPKVPRTPPAEELAEPQAAGGGQKKGDKAPGGG
GANLKGDRSRLLRDLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGS
MSGLGC
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgcatctctcccagctgctggcctgcgccctgctgctcacgctgctctccctccggccc
tccgaagccaagcccggggcgccgccgaaggtcccgcgaaccccgccggcagaggagctg
gccgagccgcaggctgcgggcggcggtcagaagaagggcgacaaggctcccgggggcggg
ggcgccaatctcaagggcgaccggtcgcgactgctccgggacctgcgcgtggacaccaag
tcgcgggcagcgtgggctcgccttctgcaagagcaccccaacgcgcgcaaatacaaagga
gccaacaagaagggcttgtccaagggctgcttcggcctcaagctggaccgaatcggctcc
atgagcggcctgggatgttag

DBGET integrated database retrieval system