KEGG   Homo sapiens (human): 4881Help
Entry
4881              CDS       T01001                                 

Gene name
NPR1, ANPRA, ANPa, GUC2A, GUCY2A, NPRA
Definition
(RefSeq) natriuretic peptide receptor 1
  KO
K12323  atrial natriuretic peptide receptor A [EC:4.6.1.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01100  Metabolic pathways
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04714  Thermogenesis
hsa04921  Oxytocin signaling pathway
hsa04923  Regulation of lipolysis in adipocytes
hsa04924  Renin secretion
hsa04925  Aldosterone synthesis and secretion
Drug target
Anaritide acetate: D02935
Carperitide: D03328
Cenderitide: D10063
Eritrityl tetranitrate: D04051
Nesiritide (DG00238): D05147 D05148
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4881 (NPR1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    4881 (NPR1)
   04022 cGMP-PKG signaling pathway
    4881 (NPR1)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    4881 (NPR1)
   04921 Oxytocin signaling pathway
    4881 (NPR1)
   04924 Renin secretion
    4881 (NPR1)
   04925 Aldosterone synthesis and secretion
    4881 (NPR1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    4881 (NPR1)
  09159 Environmental adaptation
   04714 Thermogenesis
    4881 (NPR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    4881 (NPR1)
Enzymes [BR:hsa01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     4881 (NPR1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   4881 (NPR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc ANF_receptor Pkinase_Tyr Pkinase HNOBA
Motif
Other DBs
NCBI-GeneID: 4881
NCBI-ProteinID: NP_000897
OMIM: 108960
HGNC: 7943
Ensembl: ENSG00000169418
Vega: OTTHUMG00000037085
Pharos: P16066(Tclin)
UniProt: P16066 A0A140VJE6
Position
1q21.3
AA seq 1061 aa AA seqDB search
MPGPRRPAGSRLRLLLLLLLPPLLLLLRGSHAGNLTVAVVLPLANTSYPWSWARVGPAVE
LALAQVKARPDLLPGWTVRTVLGSSENALGVCSDTAAPLAAVDLKWEHNPAVFLGPGCVY
AAAPVGRFTAHWRVPLLTAGAPALGFGVKDEYALTTRAGPSYAKLGDFVAALHRRLGWER
QALMLYAYRPGDEEHCFFLVEGLFMRVRDRLNITVDHLEFAEDDLSHYTRLLRTMPRKGR
VIYICSSPDAFRTLMLLALEAGLCGEDYVFFHLDIFGQSLQGGQGPAPRRPWERGDGQDV
SARQAFQAAKIITYKDPDNPEYLEFLKQLKHLAYEQFNFTMEDGLVNTIPASFHDGLLLY
IQAVTETLAHGGTVTDGENITQRMWNRSFQGVTGYLKIDSSGDRETDFSLWDMDPENGAF
RVVLNYNGTSQELVAVSGRKLNWPLGYPPPDIPKCGFDNEDPACNQDHLSTLEVLALVGS
LSLLGILIVSFFIYRKMQLEKELASELWRVRWEDVEPSSLERHLRSAGSRLTLSGRGSNY
GSLLTTEGQFQVFAKTAYYKGNLVAVKRVNRKRIELTRKVLFELKHMRDVQNEHLTRFVG
ACTDPPNICILTEYCPRGSLQDILENESITLDWMFRYSLTNDIVKGMLFLHNGAICSHGN
LKSSNCVVDGRFVLKITDYGLESFRDLDPEQGHTVYAKKLWTAPELLRMASPPVRGSQAG
DVYSFGIILQEIALRSGVFHVEGLDLSPKEIIERVTRGEQPPFRPSLALQSHLEELGLLM
QRCWAEDPQERPPFQQIRLTLRKFNRENSSNILDNLLSRMEQYANNLEELVEERTQAYLE
EKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTL
LNDLYTCFDAVIDNFDVYKVETIGDAYMVVSGLPVRNGRLHACEVARMALALLDAVRSFR
IRHRPQEQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHLSSET
KAVLEEFGGFELELRGDVEMKGKGKVRTYWLLGERGSSTRG
NT seq 3186 nt NT seq  +upstreamnt  +downstreamnt
atgccggggccccggcgccccgctggctcccgcctgcgcctgctcctgctcctgctgctg
ccgccgctgctgctgctgctccggggcagccacgcgggcaacctgacggtagccgtggta
ctgccgctggccaatacctcgtacccctggtcgtgggcgcgcgtgggacccgccgtggag
ctggccctggcccaggtgaaggcgcgccccgacttgctgccgggctggacggtccgcacg
gtgctgggcagcagcgaaaacgcgctgggcgtctgctccgacaccgcagcgcccctggcc
gcggtggacctcaagtgggagcacaaccccgctgtgttcctgggccccggctgcgtgtac
gccgccgccccagtggggcgcttcaccgcgcactggcgggtcccgctgctgaccgccggc
gccccggcgctgggcttcggtgtcaaggacgagtatgcgctgaccacccgcgcggggccc
agctacgccaagctgggggacttcgtggcggcgctgcaccgacggctgggctgggagcgc
caagcgctcatgctctacgcctaccggccgggtgacgaagagcactgcttcttcctcgtg
gaggggctgttcatgcgggtccgcgaccgcctcaatattacggtggaccacctggagttc
gccgaggacgacctcagccactacaccaggctgctgcggaccatgccgcgcaaaggccga
gttatctacatctgcagctcccctgatgccttcagaaccctcatgctcctggccctggaa
gctggcttgtgtggggaggactacgttttcttccacctggatatctttgggcaaagcctg
caaggtggacagggccctgctccccgcaggccctgggagagaggggatgggcaggatgtc
agtgcccgccaggcctttcaggctgccaaaatcattacatataaagacccagataatccc
gagtacttggaattcctgaagcagttaaaacacctggcctatgagcagttcaacttcacc
atggaggatggcctggtgaacaccatcccagcatccttccacgacgggctcctgctctat
atccaggcagtgacggagactctggcacatgggggaactgttactgatggggagaacatc
actcagcggatgtggaaccgaagctttcaaggtgtgacaggatacctgaaaattgatagc
agtggcgatcgggaaacagacttctccctctgggatatggatcccgagaatggtgccttc
agggttgtactgaactacaatgggacttcccaagagctggtggctgtgtcggggcgcaaa
ctgaactggcccctggggtaccctcctcctgacatccccaaatgtggctttgacaacgaa
gacccagcatgcaaccaagatcacctttccaccctggaggtgctggctttggtgggcagc
ctctccttgctcggcattctgattgtctccttcttcatatacaggaagatgcagctggag
aaggaactggcctcggagctgtggcgggtgcgctgggaggacgttgagcccagtagcctt
gagaggcacctgcggagtgcaggcagccggctgaccctgagcgggagaggctccaattac
ggctccctgctaaccacagagggccagttccaagtctttgccaagacagcatattataag
ggcaacctcgtggctgtgaaacgtgtgaaccgtaaacgcattgagctgacacgaaaagtc
ctgtttgaactgaagcatatgcgggatgtgcagaatgaacacctgaccaggtttgtggga
gcctgcaccgacccccccaatatctgcatcctcacagagtactgtccccgtgggagcctg
caggacattctggagaatgagagcatcaccctggactggatgttccggtactcactcacc
aatgacatcgtcaagggcatgctgtttctacacaatggggctatctgttcccatgggaac
ctcaagtcatccaactgcgtggtagatgggcgctttgtgctcaagatcaccgactatggg
ctggagagcttcagggacctggacccagagcaaggacacaccgtttatgccaaaaagctg
tggacggcccctgagctcctgcgaatggcttcaccccctgtgcggggctcccaggctggt
gacgtatacagctttgggatcatccttcaggagattgccctgaggagtggggtcttccac
gtggaaggtttggacctgagccccaaagagatcatcgagcgggtgactcggggtgagcag
ccccccttccggccctccctggccctgcagagtcacctggaggagttggggctgctcatg
cagcggtgctgggctgaggacccacaggagaggccaccattccagcagatccgcctgacg
ttgcgcaaatttaacagggagaacagcagcaacatcctggacaacctgctgtcccgcatg
gagcagtacgcgaacaatctggaggaactggtggaggagcggacccaggcatacctggag
gagaagcgcaaggctgaggccctgctctaccagatcctgcctcactcagtggctgagcag
ctgaagcgtggggagacggtgcaggccgaagcctttgacagtgttaccatctacttcagt
gacattgtgggtttcacagcgctgtcggcggagagcacacccatgcaggtggtgaccctg
ctcaatgacctgtacacttgctttgatgctgtcatagacaactttgatgtgtacaaggtg
gagacaattggcgatgcctacatggtggtgtcagggctccctgtgcggaacgggcggcta
cacgcctgcgaggtagcccgcatggccctggcactgctggatgctgtgcgctccttccga
atccgccaccggccccaggagcagctgcgcttgcgcattggcatccacacaggacctgtg
tgtgctggagtggtgggactgaagatgccccgttactgtctctttggggatacagtcaac
acagcctcaagaatggagtctaatggggaagccctgaagatccacttgtcttctgagacc
aaggctgtcctggaggagtttggtggtttcgagctggagcttcgaggggatgtagaaatg
aagggcaaaggcaaggttcggacctactggctccttggggagagggggagtagcacccga
ggctga

DBGET integrated database retrieval system