KEGG   Homo sapiens (human): 4882Help
Entry
4882              CDS       T01001                                 

Gene name
NPR2, AMDM, ANPRB, ANPb, ECDM, GUC2B, GUCY2B, NPRB, NPRBi, SNSK
Definition
(RefSeq) natriuretic peptide receptor 2
  KO
K12324  atrial natriuretic peptide receptor B [EC:4.6.1.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa04022  cGMP-PKG signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04921  Oxytocin signaling pathway
Module
hsa_M00694  cGMP signaling
Disease
H00470  Acromesomelic dysplasia, Maroteaux type
Drug target
Cenderitide: D10063
Eritrityl tetranitrate: D04051
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    4882 (NPR2)
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    4882 (NPR2)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    4882 (NPR2)
  Circulatory system
   04270 Vascular smooth muscle contraction
    4882 (NPR2)
Enzymes [BR:hsa01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     4882 (NPR2)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   4882 (NPR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc ANF_receptor Pkinase_Tyr Pkinase Peripla_BP_6 HNOBA
Motif
Other DBs
NCBI-GeneID: 4882
NCBI-ProteinID: NP_003986
OMIM: 108961
HGNC: 7944
Ensembl: ENSG00000159899
Vega: OTTHUMG00000019871
Pharos: P20594(Tbio)
UniProt: P20594
Position
9p13.3
AA seq 1047 aa AA seqDB search
MALPSLLLLVAALAGGVRPPGARNLTLAVVLPEHNLSYAWAWPRVGPAVALAVEALGRAL
PVDLRFVSSELEGACSEYLAPLSAVDLKLYHDPDLLLGPGCVYPAASVARFASHWRLPLL
TAGAVASGFSAKNDHYRTLVRTGPSAPKLGEFVVTLHGHFNWTARAALLYLDARTDDRPH
YFTIEGVFEALQGSNLSVQHQVYAREPGGPEQATHFIRANGRIVYICGPLEMLHEILLQA
QRENLTNGDYVFFYLDVFGESLRAGPTRATGRPWQDNRTREQAQALREAFQTVLVITYRE
PPNPEYQEFQNRLLIRAREDFGVELGPSLMNLIAGCFYDGILLYAEVLNETIQEGGTRED
GLRIVEKMQGRRYHGVTGLVVMDKNNDRETDFVLWAMGDLDSGDFQPAAHYSGAEKQIWW
TGRPIPWVKGAPPSDNPPCAFDLDDPSCDKTPLSTLAIVALGTGITFIMFGVSSFLIFRK
LMLEKELASMLWRIRWEELQFGNSERYHKGAGSRLTLSLRGSSYGSLMTAHGKYQIFANT
GHFKGNVVAIKHVNKKRIELTRQVLFELKHMRDVQFNHLTRFIGACIDPPNICIVTEYCP
RGSLQDILENDSINLDWMFRYSLINDLVKGMAFLHNSIISSHGSLKSSNCVVDSRFVLKI
TDYGLASFRSTAEPDDSHALYAKKLWTAPELLSGNPLPTTGMQKADVYSFGIILQEIALR
SGPFYLEGLDLSPKEIVQKVRNGQRPYFRPSIDRTQLNEELVLLMERCWAQDPAERPDFG
QIKGFIRRFNKEGGTSILDNLLLRMEQYANNLEKLVEERTQAYLEEKRKAEALLYQILPH
SVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAIIDNF
DVYKVETIGDAYMVVSGLPGRNGQRHAPEIARMALALLDAVSSFRIRHRPHDQLRLRIGV
HTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGQALKIHVSSTTKDALDELGCFQLELR
GDVEMKGKGKMRTYWLLGERKGPPGLL
NT seq 3144 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgccatcacttctgctgttggtggcagccctggcaggtggggtgcgtcctccc
ggggcgcggaacctgacgctggcggtggtgctgccagaacacaacctgagctatgcctgg
gcctggccacgggtgggacccgctgtggcactagctgtggaggctctgggccgggcactg
cccgtggacctgcggtttgtcagctccgaactggaaggcgcctgctctgagtacctggca
ccgctgagcgctgtggacctcaagctgtaccatgaccccgacctgctgttaggtcccggt
tgcgtgtaccctgctgcctctgtggcccgctttgcctcccactggcgccttcccctgctg
actgcgggtgctgtggcctctggtttttcggctaagaatgaccattatcgtaccctggtt
cgcactggcccctctgctcccaagctgggtgagtttgtggtgacactacacgggcacttc
aattggactgcccgtgctgccttgctgtacctggatgctcgcacagatgaccggcctcac
tacttcaccatcgagggcgtctttgaggccctgcagggcagcaacctcagtgtgcagcac
caggtgtatgcccgagagccagggggccccgagcaggccacccacttcatccgggccaac
gggcgcattgtgtatatctgcggccctctggagatgctgcatgagatcctgcttcaggcc
cagagggagaatctgaccaatggggattatgtcttcttttacctggatgtctttggggag
agtctccgtgcaggccccacacgtgctacaggccggccctggcaggacaatcgcacccgg
gaacaggcccaggccctcagagaggcctttcagactgtattggtgatcacgtaccgagaa
cccccaaatcctgagtatcaggaattccagaatcgtctgctgataagagcccgggaagac
tttggtgtggagctgggcccttccctgatgaacctcatcgctggctgcttctatgatggg
atcctgctatatgctgaagtcctgaatgagacaatacaggaaggaggcacccgggaggat
ggacttcgaattgtggaaaagatgcagggacgaagatatcacggtgtaactgggctggtt
gtcatggacaagaacaatgaccgagagactgactttgtcctctgggccatgggagacctg
gattctggggactttcagcctgcagcccactactcgggagctgagaagcagatttggtgg
acgggacggcctattccctgggtgaagggggctcctccctcggacaatcccccctgtgcc
tttgacttggacgacccatcctgtgataaaactccactttcaaccctggcaattgtggct
ctgggcacaggaatcaccttcatcatgtttggtgtttccagcttcctaattttccgaaag
ctgatgctggagaaggagctggctagcatgttgtggcgtattcgctgggaagaactgcag
tttggcaactcagagcgttatcacaaaggtgcaggcagtcgcctcacactgtcgctgcgg
ggatccagttacggctcgctcatgacagcccatgggaaataccagatctttgccaacacc
ggtcacttcaagggaaatgttgtcgccatcaaacatgtgaataagaagcgcattgagctg
acccggcaggttctgtttgaactcaaacatatgagagatgttcagttcaaccatctcact
cgcttcattggcgcctgcatagaccctcccaacatttgcattgtcactgaatactgtcct
cgtgggagtttacaggatattctagaaaatgacagcatcaacttggactggatgtttcgt
tattcactcattaatgaccttgttaagggcatggcctttctccacaacagcattatttca
tcgcatgggagtctcaagtcctccaactgtgtggtggatagtcgttttgtgctcaaaatc
acagactatggcctggccagcttccgatcaactgctgaacctgatgacagccatgccctc
tatgccaagaagctgtggactgccccagaactgctcagtgggaaccccttgccaaccaca
ggcatgcagaaggctgacgtctatagctttgggatcatcctgcaggagatagcacttcgc
agtggtcctttctacttggagggcctggacctcagccccaaagagattgtccagaaggta
cgaaatggtcagcggccatatttccggccaagcattgaccggacccaactgaatgaagag
ctagttttgctgatggagcgatgttgggctcaggacccagctgagcggccagactttgga
cagattaagggcttcattcggcgctttaacaaggagggtggcaccagcatattggacaac
ctcctgctgcgcatggaacagtatgccaataacttggagaagctggtggaggaacgcaca
caggcctatctggaggaaaaacgcaaggctgaagctctgctctaccaaatcctaccccat
tcagtggcagagcagttaaaacggggagagactgtacaggctgaggcctttgacagtgtt
accatctacttcagtgacattgttggcttcacagcattgtcagcagagagcacccccatg
caggtagtgacacttcttaatgacctgtatacctgctttgatgccataattgacaacttt
gatgtctacaaggtggagacgattggggatgcttacatggtggtatctggcctcccaggc
cgaaatggtcaacgccatgcaccagaaattgctcgtatggccctagcattactagatgca
gtttcttcctttcgcatccgccaccgaccccatgaccagctgaggctacgcataggggtc
catactgggccagtctgtgctggggttgttggcctgaagatgccccgttattgtcttttt
ggagacacagtgaacactgcttctcgaatggagtctaatggtcaagcgctgaagatccat
gtctcctctaccaccaaggatgccctagatgagctaggatgcttccagctagagcttcgg
ggggatgtggaaatgaagggaaaaggaaagatgcgaacatactggctcttaggagagcgg
aaaggacctcctggactcctgtaa

DBGET integrated database retrieval system