KEGG   Homo sapiens (human): 4882Help
Entry
4882              CDS       T01001                                 

Gene name
NPR2, AMDM, ANPRB, ANPb, ECDM, GUC2B, GUCY2B, NPRB, NPRBi, SNSK
Definition
(RefSeq) natriuretic peptide receptor 2
  KO
K12324  atrial natriuretic peptide receptor B [EC:4.6.1.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01100  Metabolic pathways
hsa04022  cGMP-PKG signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04921  Oxytocin signaling pathway
Disease
H00470  Acromesomelic dysplasia, Maroteaux type
Drug target
Anaritide acetate: D02935
Cenderitide: D10063
Eritrityl tetranitrate: D04051
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4882 (NPR2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    4882 (NPR2)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    4882 (NPR2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    4882 (NPR2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    4882 (NPR2)
Enzymes [BR:hsa01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     4882 (NPR2)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   4882 (NPR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc ANF_receptor Pkinase_Tyr Pkinase Peripla_BP_6 HNOBA
Motif
Other DBs
NCBI-GeneID: 4882
NCBI-ProteinID: NP_003986
OMIM: 108961
HGNC: 7944
Ensembl: ENSG00000159899
Vega: OTTHUMG00000019871
Pharos: P20594(Tbio)
UniProt: P20594
Position
9p13.3
AA seq 1047 aa AA seqDB search
MALPSLLLLVAALAGGVRPPGARNLTLAVVLPEHNLSYAWAWPRVGPAVALAVEALGRAL
PVDLRFVSSELEGACSEYLAPLSAVDLKLYHDPDLLLGPGCVYPAASVARFASHWRLPLL
TAGAVASGFSAKNDHYRTLVRTGPSAPKLGEFVVTLHGHFNWTARAALLYLDARTDDRPH
YFTIEGVFEALQGSNLSVQHQVYAREPGGPEQATHFIRANGRIVYICGPLEMLHEILLQA
QRENLTNGDYVFFYLDVFGESLRAGPTRATGRPWQDNRTREQAQALREAFQTVLVITYRE
PPNPEYQEFQNRLLIRAREDFGVELGPSLMNLIAGCFYDGILLYAEVLNETIQEGGTRED
GLRIVEKMQGRRYHGVTGLVVMDKNNDRETDFVLWAMGDLDSGDFQPAAHYSGAEKQIWW
TGRPIPWVKGAPPSDNPPCAFDLDDPSCDKTPLSTLAIVALGTGITFIMFGVSSFLIFRK
LMLEKELASMLWRIRWEELQFGNSERYHKGAGSRLTLSLRGSSYGSLMTAHGKYQIFANT
GHFKGNVVAIKHVNKKRIELTRQVLFELKHMRDVQFNHLTRFIGACIDPPNICIVTEYCP
RGSLQDILENDSINLDWMFRYSLINDLVKGMAFLHNSIISSHGSLKSSNCVVDSRFVLKI
TDYGLASFRSTAEPDDSHALYAKKLWTAPELLSGNPLPTTGMQKADVYSFGIILQEIALR
SGPFYLEGLDLSPKEIVQKVRNGQRPYFRPSIDRTQLNEELVLLMERCWAQDPAERPDFG
QIKGFIRRFNKEGGTSILDNLLLRMEQYANNLEKLVEERTQAYLEEKRKAEALLYQILPH
SVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAIIDNF
DVYKVETIGDAYMVVSGLPGRNGQRHAPEIARMALALLDAVSSFRIRHRPHDQLRLRIGV
HTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGQALKIHVSSTTKDALDELGCFQLELR
GDVEMKGKGKMRTYWLLGERKGPPGLL
NT seq 3144 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgccatcacttctgctgttggtggcagccctggcaggtggggtgcgtcctccc
ggggcgcggaacctgacgctggcggtggtgctgccagaacacaacctgagctatgcctgg
gcctggccacgggtgggacccgctgtggcactagctgtggaggctctgggccgggcactg
cccgtggacctgcggtttgtcagctccgaactggaaggcgcctgctctgagtacctggca
ccgctgagcgctgtggacctcaagctgtaccatgaccccgacctgctgttaggtcccggt
tgcgtgtaccctgctgcctctgtggcccgctttgcctcccactggcgccttcccctgctg
actgcgggtgctgtggcctctggtttttcggctaagaatgaccattatcgtaccctggtt
cgcactggcccctctgctcccaagctgggtgagtttgtggtgacactacacgggcacttc
aattggactgcccgtgctgccttgctgtacctggatgctcgcacagatgaccggcctcac
tacttcaccatcgagggcgtctttgaggccctgcagggcagcaacctcagtgtgcagcac
caggtgtatgcccgagagccagggggccccgagcaggccacccacttcatccgggccaac
gggcgcattgtgtatatctgcggccctctggagatgctgcatgagatcctgcttcaggcc
cagagggagaatctgaccaatggggattatgtcttcttttacctggatgtctttggggag
agtctccgtgcaggccccacacgtgctacaggccggccctggcaggacaatcgcacccgg
gaacaggcccaggccctcagagaggcctttcagactgtattggtgatcacgtaccgagaa
cccccaaatcctgagtatcaggaattccagaatcgtctgctgataagagcccgggaagac
tttggtgtggagctgggcccttccctgatgaacctcatcgctggctgcttctatgatggg
atcctgctatatgctgaagtcctgaatgagacaatacaggaaggaggcacccgggaggat
ggacttcgaattgtggaaaagatgcagggacgaagatatcacggtgtaactgggctggtt
gtcatggacaagaacaatgaccgagagactgactttgtcctctgggccatgggagacctg
gattctggggactttcagcctgcagcccactactcgggagctgagaagcagatttggtgg
acgggacggcctattccctgggtgaagggggctcctccctcggacaatcccccctgtgcc
tttgacttggacgacccatcctgtgataaaactccactttcaaccctggcaattgtggct
ctgggcacaggaatcaccttcatcatgtttggtgtttccagcttcctaattttccgaaag
ctgatgctggagaaggagctggctagcatgttgtggcgtattcgctgggaagaactgcag
tttggcaactcagagcgttatcacaaaggtgcaggcagtcgcctcacactgtcgctgcgg
ggatccagttacggctcgctcatgacagcccatgggaaataccagatctttgccaacacc
ggtcacttcaagggaaatgttgtcgccatcaaacatgtgaataagaagcgcattgagctg
acccggcaggttctgtttgaactcaaacatatgagagatgttcagttcaaccatctcact
cgcttcattggcgcctgcatagaccctcccaacatttgcattgtcactgaatactgtcct
cgtgggagtttacaggatattctagaaaatgacagcatcaacttggactggatgtttcgt
tattcactcattaatgaccttgttaagggcatggcctttctccacaacagcattatttca
tcgcatgggagtctcaagtcctccaactgtgtggtggatagtcgttttgtgctcaaaatc
acagactatggcctggccagcttccgatcaactgctgaacctgatgacagccatgccctc
tatgccaagaagctgtggactgccccagaactgctcagtgggaaccccttgccaaccaca
ggcatgcagaaggctgacgtctatagctttgggatcatcctgcaggagatagcacttcgc
agtggtcctttctacttggagggcctggacctcagccccaaagagattgtccagaaggta
cgaaatggtcagcggccatatttccggccaagcattgaccggacccaactgaatgaagag
ctagttttgctgatggagcgatgttgggctcaggacccagctgagcggccagactttgga
cagattaagggcttcattcggcgctttaacaaggagggtggcaccagcatattggacaac
ctcctgctgcgcatggaacagtatgccaataacttggagaagctggtggaggaacgcaca
caggcctatctggaggaaaaacgcaaggctgaagctctgctctaccaaatcctaccccat
tcagtggcagagcagttaaaacggggagagactgtacaggctgaggcctttgacagtgtt
accatctacttcagtgacattgttggcttcacagcattgtcagcagagagcacccccatg
caggtagtgacacttcttaatgacctgtatacctgctttgatgccataattgacaacttt
gatgtctacaaggtggagacgattggggatgcttacatggtggtatctggcctcccaggc
cgaaatggtcaacgccatgcaccagaaattgctcgtatggccctagcattactagatgca
gtttcttcctttcgcatccgccaccgaccccatgaccagctgaggctacgcataggggtc
catactgggccagtctgtgctggggttgttggcctgaagatgccccgttattgtcttttt
ggagacacagtgaacactgcttctcgaatggagtctaatggtcaagcgctgaagatccat
gtctcctctaccaccaaggatgccctagatgagctaggatgcttccagctagagcttcgg
ggggatgtggaaatgaagggaaaaggaaagatgcgaacatactggctcttaggagagcgg
aaaggacctcctggactcctgtaa

DBGET integrated database retrieval system