KEGG   Homo sapiens (human): 4883Help
Entry
4883              CDS       T01001                                 

Gene name
NPR3, ANP-C, ANPR-C, ANPRC, C5orf23, GUCY2B, NPR-C, NPRC
Definition
(RefSeq) natriuretic peptide receptor 3
  KO
K12325  atrial natriuretic peptide clearance receptor
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    4883 (NPR3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor Peripla_BP_6
Motif
Other DBs
NCBI-GeneID: 4883
NCBI-ProteinID: NP_001191304
OMIM: 108962
HGNC: 7945
Ensembl: ENSG00000113389
Vega: OTTHUMG00000150316
Pharos: P17342(Tchem)
UniProt: P17342 A8K4A5
Structure
PDB: 

Position
5p13.3
AA seq 541 aa AA seqDB search
MPSLLVLTFSPCVLLGWALLAGGTGGGGVGGGGGGAGIGGGRQEREALPPQKIEVLVLLP
QDDSYLFSLTRVRPAIEYALRSVEGNGTGRRLLPPGTRFQVAYEDSDCGNRALFSLVDRV
AAARGAKPDLILGPVCEYAAAPVARLASHWDLPMLSAGALAAGFQHKDSEYSHLTRVAPA
YAKMGEMMLALFRHHHWSRAALVYSDDKLERNCYFTLEGVHEVFQEEGLHTSIYSFDETK
DLDLEDIVRNIQASERVVIMCASSDTIRSIMLVAHRHGMTSGDYAFFNIELFNSSSYGDG
SWKRGDKHDFEAKQAYSSLQTVTLLRTVKPEFEKFSMEVKSSVEKQGLNMEDYVNMFVEG
FHDAILLYVLALHEVLRAGYSKKDGGKIIQQTWNRTFEGIAGQVSIDANGDRYGDFSVIA
MTDVEAGTQEVIGDYFGKEGRFEMRPNVKYPWGPLKLRIDENRIVEHTNSSPCKSSGGLE
ESAVTGIVVGALLGAGLLMAFYFFRKKYRITIERRTQQEESNLGKHRELREDSIRSHFSV
A
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgccgtctctgctggtgctcactttctccccgtgcgtactactcggctgggcgttgctg
gccggcggcaccggtggcggtggcgttggcggcggcggcggtggcgcgggcataggcggc
ggacgccaggagagagaggcgctgccgccacagaagatcgaggtgctggtgttactgccc
caggatgactcgtacttgttttcactcacccgggtgcggccggccatcgagtatgctctg
cgcagcgtggagggcaacgggactgggaggcggcttctgccgccgggcactcgcttccag
gtggcttacgaggattcagactgtgggaaccgtgcgctcttcagcttggtggaccgcgtg
gcggcggcgcggggcgccaagccagaccttatcctggggccagtgtgcgagtatgcagca
gcgccagtggcccggcttgcatcgcactgggacctgcccatgctgtcggctggggcgctg
gccgctggcttccagcacaaggactctgagtactcgcacctcacgcgcgtggcgcccgcc
tacgccaagatgggcgagatgatgctcgccctgttccgccaccaccactggagccgcgct
gcactggtctacagcgacgacaagctggagcggaactgctacttcaccctcgagggggtc
cacgaggtcttccaggaggagggtttgcacacgtccatctacagtttcgacgagaccaaa
gacttggatctggaagacatcgtgcgcaatatccaggccagtgagagagtggtgatcatg
tgtgcgagcagtgacaccatccggagcatcatgctggtggcgcacaggcatggcatgacc
agtggagactacgccttcttcaacattgagctcttcaacagctcttcctatggagatggc
tcatggaagagaggagacaaacacgactttgaagctaagcaagcatactcgtccctccag
acagtcactctactgaggacagtgaaacctgagtttgagaagttttccatggaggtgaaa
agttcagttgagaaacaagggctcaatatggaggattacgttaacatgtttgttgaagga
ttccacgatgccatcctcctctacgtcttggctctacatgaagtactcagagctggttac
agcaaaaaggatggagggaaaattatacagcagacttggaacagaacatttgaaggtatc
gccgggcaggtgtccatagatgccaacggagaccgatatggggatttctctgtgattgcc
atgactgatgtggaggcgggcacccaggaggttattggtgattattttggaaaagaaggt
cgttttgaaatgcggccgaatgtcaaatatccttggggccctttaaaactgagaatagat
gaaaaccgaattgtagagcatacaaacagctctccctgcaaatcatcaggtggcctagaa
gaatcggcagtgacaggaattgtcgtgggggctttactaggagctggcttgctaatggcc
ttctactttttcaggaagaaatacagaataaccattgagaggcgaacccagcaagaagaa
agtaaccttggaaaacatcgggaattacgggaagattccatcagatcccatttttcagta
gcttaa

DBGET integrated database retrieval system