KEGG   Homo sapiens (human): 4886Help
Entry
4886              CDS       T01001                                 

Gene name
NPY1R, NPY1-R, NPYR
Definition
(RefSeq) neuropeptide Y receptor Y1
  KO
K04204  neuropeptide Y receptor type 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    4886 (NPY1R)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    4886 (NPY1R)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    4886 (NPY1R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    4886 (NPY1R)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Neuropeptide Y
    4886 (NPY1R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx Git3 Gaa1
Motif
Other DBs
NCBI-GeneID: 4886
NCBI-ProteinID: NP_000900
OMIM: 162641
HGNC: 7956
Ensembl: ENSG00000164128
Vega: OTTHUMG00000161371
Pharos: P25929(Tchem)
UniProt: P25929
Position
4q32.2
AA seq 384 aa AA seqDB search
MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLA
LIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQ
CVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMT
DEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKR
RNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNL
LFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVS
KTSLKQASPVAFKKINNNDDNEKI
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaattcaacattattttcccaggttgaaaatcattcagtccactctaatttctcagag
aagaatgcccagcttctggcttttgaaaatgatgattgtcatctgcccttggccatgata
tttaccttagctcttgcttatggagctgtgatcattcttggtgtctctggaaacctggcc
ttgatcataatcatcttgaaacaaaaggagatgagaaatgttaccaacatcctgattgtg
aacctttccttctcagacttgcttgttgccatcatgtgtctcccctttacatttgtctac
acattaatggaccactgggtctttggtgaggcgatgtgtaagttgaatccttttgtgcaa
tgtgtttcaatcactgtgtccattttctctctggttctcattgctgtggaacgacatcag
ctgataatcaaccctcgagggtggagaccaaataatagacatgcttatgtaggtattgct
gtgatttgggtccttgctgtggcttcttctttgcctttcctgatctaccaagtaatgact
gatgagccgttccaaaatgtaacacttgatgcgtacaaagacaaatacgtgtgctttgat
caatttccatcggactctcataggttgtcttataccactctcctcttggtgctgcagtat
tttggtccactttgttttatatttatttgctacttcaagatatatatacgcctaaaaagg
agaaacaacatgatggacaagatgagagacaataagtacaggtccagtgaaaccaaaaga
atcaatatcatgctgctctccattgtggtagcatttgcagtctgctggctccctcttacc
atctttaacactgtgtttgattggaatcatcagatcattgctacctgcaaccacaatctg
ttattcctgctctgccacctcacagcaatgatatccacttgtgtcaaccccatattttat
gggttcctgaacaaaaacttccagagagacttgcagttcttcttcaacttttgtgatttc
cggtctcgggatgatgattatgaaacaatagccatgtccacgatgcacacagatgtttcc
aaaacttctttgaagcaagcaagcccagtcgcatttaaaaaaatcaacaacaatgatgat
aatgaaaaaatctga

DBGET integrated database retrieval system