KEGG   Homo sapiens (human): 4887Help
Entry
4887              CDS       T01001                                 

Gene name
NPY2R, NPY2-R
Definition
(RefSeq) neuropeptide Y receptor Y2
  KO
K04205  neuropeptide Y receptor type 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    4887 (NPY2R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    4887 (NPY2R)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Neuropeptide Y
    4887 (NPY2R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Motif
Other DBs
NCBI-GeneID: 4887
NCBI-ProteinID: NP_000901
OMIM: 162642
HGNC: 7957
Ensembl: ENSG00000185149
Vega: OTTHUMG00000161485
Pharos: P49146(Tchem)
UniProt: P49146
Position
4q32.1
AA seq 381 aa AA seqDB search
MGPIGAEADENQTVEEMKVEQYGPQTTPRGELVPDPEPELIDSTKLIEVQVVLILAYCSI
ILLGVIGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGP
VLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLA
SPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSIYGTVYSLSSLLILYVLPLGIISFSYT
RIWSKLKNHVSPGAANDHYHQRRQKTTKMLVCVVVVFAVSWLPLHAFQLAVDIDSQVLDL
KEYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIHSEVSVTFKAK
KNLEVRKNSGPNDSFTEATNV
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgggtccaataggtgcagaggctgatgagaaccagacagtggaagaaatgaaggtggaa
caatacgggccacaaacaactcctagaggtgaactggtccctgaccctgagccagagctt
atagatagtaccaagctgattgaggtacaagttgttctcatattggcctactgctccatc
atcttgcttggggtaattggcaactccttggtgatccatgtggtgatcaaattcaagagc
atgcgcacagtaaccaactttttcattgccaatctggctgtggcagatcttttggtgaac
actctgtgtctaccgttcactcttacctataccttaatgggggagtggaaaatgggtcct
gtcctgtgccacctggtgccctatgcccagggcctggcagtacaagtatccacaatcacc
ttgacagtaattgccctggaccggcacaggtgcatcgtctaccacctagagagcaagatc
tccaagcgaatcagcttcctgattattggcttggcctggggcatcagtgccctgctggca
agtcccctggccatcttccgggagtattcgctgattgagatcatcccggactttgagatt
gtggcctgtactgaaaagtggcctggcgaggagaagagcatctatggcactgtctatagt
ctttcttccttgttgatcttgtatgttttgcctctgggcattatatcattttcctacact
cgcatttggagtaaattgaagaaccatgtcagtcctggagctgcaaatgaccactaccat
cagcgaaggcaaaaaaccaccaaaatgctggtgtgtgtggtggtggtgtttgcggtcagc
tggctgcctctccatgccttccagcttgccgttgacattgacagccaggtcctggacctg
aaggagtacaaactcatcttcacagtgttccacatcatcgccatgtgctccacttttgcc
aatccccttctctatggctggatgaacagcaactacagaaaggctttcctctcggccttc
cgctgtgagcagcggttggatgccattcactctgaggtgtccgtgacattcaaggctaaa
aagaacctggaggtcagaaagaacagtggccccaatgactctttcacagaggctaccaat
gtctaa

DBGET integrated database retrieval system