KEGG   Homo sapiens (human): 4889Help
Entry
4889              CDS       T01001                                 

Gene name
NPY5R, NPY5-R, NPYR5, NPYY5-R
Definition
(RefSeq) neuropeptide Y receptor Y5
  KO
K04207  neuropeptide Y receptor type 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Drug target
Velneperit: D08026
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    4889 (NPY5R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    4889 (NPY5R)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Neuropeptide Y
    4889 (NPY5R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srw
Motif
Other DBs
NCBI-GeneID: 4889
NCBI-ProteinID: NP_001304020
OMIM: 602001
HGNC: 7958
Ensembl: ENSG00000164129
Vega: OTTHUMG00000161353
Pharos: Q15761(Tchem)
UniProt: Q15761
Position
4q32.2
AA seq 445 aa AA seqDB search
MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNL
LILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFL
QCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSL
VELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISC
GLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAP
ERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIK
KRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCL
NPILYGFLNNGIKADLVSLIHCLHM
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggatttagagctcgacgagtattataacaagacacttgccacagagaataatactgct
gccactcggaattctgatttcccagtctgggatgactataaaagcagtgtagatgactta
cagtattttctgattgggctctatacatttgtaagtcttcttggctttatggggaatcta
cttattttaatggctctcatgaaaaagcgtaatcagaagactacggtaaacttcctcata
ggcaatctggccttttctgatatcttggttgtgctgttttgctcacctttcacactgacg
tctgtcttgctggatcagtggatgtttggcaaagtcatgtgccatattatgccttttctt
caatgtgtgtcagttttggtttcaactttaattttaatatcaattgccattgtcaggtat
catatgataaaacatcccatatctaataatttaacagcaaaccatggctactttctgata
gctactgtctggacactaggttttgccatctgttctccccttccagtgtttcacagtctt
gtggaacttcaagaaacatttggttcagcattgctgagcagcaggtatttatgtgttgag
tcatggccatctgattcatacagaattgcctttactatctctttattgctagttcagtat
attctgcccttagtttgtcttactgtaagtcatacaagtgtctgcagaagtataagctgt
ggattgtccaacaaagaaaacagacttgaagaaaatgagatgatcaacttaactcttcat
ccatccaaaaagagtgggcctcaggtgaaactctctggcagccataaatggagttattca
ttcatcaaaaaacacagaagaagatatagcaagaagacagcatgtgtgttacctgctcca
gaaagaccttctcaagagaaccactccagaatacttccagaaaactttggctctgtaaga
agtcagctctcttcatccagtaagttcataccaggggtccccacttgctttgagataaaa
cctgaagaaaattcagatgttcatgaattgagagtaaaacgttctgttacaagaataaaa
aagagatctcgaagtgttttctacagactgaccatactgatattagtatttgctgttagt
tggatgccactacaccttttccatgtggtaactgattttaatgacaatcttatttcaaat
aggcatttcaagttggtgtattgcatttgtcatttgttgggcatgatgtcctgttgtctt
aatccaattctatatgggtttcttaataatgggattaaagctgatttagtgtcccttata
cactgtcttcatatgtaa

DBGET integrated database retrieval system