KEGG   Homo sapiens (human): 49Help
Entry
49                CDS       T01001                                 

Gene name
ACR
Definition
(RefSeq) acrosin
  KO
K01317  acrosin [EC:3.4.21.10]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.10  acrosin
     49 (ACR)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   49 (ACR)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    49 (ACR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF316
Motif
Other DBs
NCBI-GeneID: 49
NCBI-ProteinID: NP_001088
OMIM: 102480
HGNC: 126
Ensembl: ENSG00000100312
Vega: OTTHUMG00000150155
Pharos: P10323(Tchem)
UniProt: P10323
Position
22q13.33
AA seq 421 aa AA seqDB search
MVEMLPTAILLVLAVSVVAKDNATCDGPCGLRFRQNPQGGVRIVGGKAAQHGAWPWMVSL
QIFTYNSHRYHTCGGSLLNSRWVLTAAHCFVGKNNVHDWRLVFGAKEITYGNNKPVKAPL
QERYVEKIIIHEKYNSATEGNDIALVEITPPISCGRFIGPGCLPHFKAGLPRGSQSCWVA
GWGYIEEKAPRPSSILMEARVDLIDLDLCNSTQWYNGRVQPTNVCAGYPVGKIDTCQGDS
GGPLMCKDSKESAYVVVGITSWGVGCARAKRPGIYTATWPYLNWIASKIGSNALRMIQSA
TPPPPTTRPPPIRPPFSHPISAHLPWYFQPPPRPLPPRPPAAQPRPPPSPPPPPPPPASP
LPPPPPPPPPTPSSTTKLPQGLSFAKRLQQLIEVLKGKTYSDGKNHYDMETTELPELTST
S
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggttgagatgctaccaactgccattctgctggtcttggcagtgtccgtggttgctaaa
gataacgccacgtgtgatggcccctgtgggttacggttcaggcaaaacccacagggtggt
gtccgcatcgtcggcgggaaggctgcacagcatggggcctggccctggatggtcagcctc
cagatcttcacgtacaacagccacaggtaccacacatgtggaggcagcttgctgaattca
cgatgggtgctcactgctgctcactgcttcgtcggcaaaaataatgtgcatgactggaga
ctggttttcggagcaaaggaaattacatatgggaacaataaaccagtaaaggcgcctctg
caagagagatatgtggagaaaatcatcattcatgaaaaatacaactctgcgacagaggga
aatgacattgccctcgtggagatcacccctcccatttcgtgtgggcgcttcattgggccg
ggctgcctgccccactttaaggcaggcctccccagaggctcccagagctgctgggtggcc
ggctggggatatatagaagagaaagcccccaggccatcatctatactgatggaggcacgt
gtggatctcatcgacctggacttgtgtaactcgacccagtggtacaatgggcgcgttcag
ccaaccaatgtgtgcgcggggtatcctgtaggcaagatcgacacctgccagggagacagc
ggcgggcctctcatgtgcaaagacagcaaggaaagcgcctatgtggtcgtgggaatcaca
agctggggggtaggctgtgcccgtgccaagcgccccggaatctacacggccacctggccc
tatctgaactggatcgcctccaagattggttctaacgctttgcgtatgattcaatcggcc
acccctccacctcccaccactcgaccgcccccgattcgaccccccttctcccaccctatc
tctgctcaccttccttggtatttccaaccgccccctcgaccacttccaccccgaccaccg
gcagcccagccccgacccccaccttcacccccgcccccacccccacctccagcctcacct
ttacccccacccccacccccacccccacctacaccctcatctaccacaaaacttccccaa
ggactttcttttgccaagcgcctacagcagctcatagaggtcttgaaggggaagacctat
tccgacggaaagaaccattatgacatggagaccacagagctcccagaactgacctcgacc
tcctga

DBGET integrated database retrieval system