KEGG   Homo sapiens (human): 490
Entry
490               CDS       T01001                                 

Gene name
ATP2B1, PMCA1, PMCA1kb
Definition
(RefSeq) ATPase plasma membrane Ca2+ transporting 1
  KO
K05850  P-type Ca2+ transporter type 2B [EC:7.2.2.10]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04925  Aldosterone synthesis and secretion
hsa04961  Endocrine and other factor-regulated calcium reabsorption
hsa04970  Salivary secretion
hsa04972  Pancreatic secretion
hsa04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    490 (ATP2B1)
   04024 cAMP signaling pathway
    490 (ATP2B1)
   04022 cGMP-PKG signaling pathway
    490 (ATP2B1)
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    490 (ATP2B1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    490 (ATP2B1)
  09154 Digestive system
   04970 Salivary secretion
    490 (ATP2B1)
   04972 Pancreatic secretion
    490 (ATP2B1)
   04978 Mineral absorption
    490 (ATP2B1)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    490 (ATP2B1)
Enzymes [BR:hsa01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     490 (ATP2B1)
SSDB
Motif
Pfam: Cation_ATPase_C E1-E2_ATPase ATP_Ca_trans_C Cation_ATPase Cation_ATPase_N Hydrolase Hydrolase_3 DUF2201_N
Other DBs
NCBI-GeneID: 490
NCBI-ProteinID: NP_001673
OMIM: 108731
HGNC: 814
Ensembl: ENSG00000070961
Vega: OTTHUMG00000169946
Pharos: P20020(Tbio)
UniProt: P20020 A0A024RBC7
Structure
PDB: 
6A69

Position
12q21.33
AA seq 1220 aa
MGDMANNSVAYSGVKNSLKEANHDGDFGITLAELRALMELRSTDALRKIQESYGDVYGIC
TKLKTSPNEGLSGNPADLERREAVFGKNFIPPKKPKTFLQLVWEALQDVTLIILEIAAIV
SLGLSFYQPPEGDNALCGEVSVGEEEGEGETGWIEGAAILLSVVCVVLVTAFNDWSKEKQ
FRGLQSRIEQEQKFTVIRGGQVIQIPVADITVGDIAQVKYGDLLPADGILIQGNDLKIDE
SSLTGESDHVKKSLDKDPLLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEEK
KDEKKKEKKNKKQDGAIENRNKAKAQDGAAMEMQPLKSEEGGDGDEKDKKKANLPKKEKS
VLQGKLTKLAVQIGKAGLLMSAITVIILVLYFVIDTFWVQKRPWLAECTPIYIQYFVKFF
IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTL
TMNRMTVVQAYINEKHYKKVPEPEAIPPNILSYLVTGISVNCAYTSKILPPEKEGGLPRH
VGNKTECALLGLLLDLKRDYQDVRNEIPEEALYKVYTFNSVRKSMSTVLKNSDGSYRIFS
KGASEIILKKCFKILSANGEAKVFRPRDRDDIVKTVIEPMASEGLRTICLAFRDFPAGEP
EPEWDNENDIVTGLTCIAVVGIEDPVRPEVPDAIKKCQRAGITVRMVTGDNINTARAIAT
KCGILHPGEDFLCLEGKDFNRRIRNEKGEIEQERIDKIWPKLRVLARSSPTDKHTLVKGI
IDSTVSDQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVK
AVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTLASL
ALATEPPTESLLLRKPYGRNKPLISRTMMKNILGHAFYQLVVVFTLLFAGEKFFDIDSGR
NAPLHAPPSEHYTIVFNTFVLMQLFNEINARKIHGERNVFEGIFNNAIFCTIVLGTFVVQ
IIIVQFGGKPFSCSELSIEQWLWSIFLGMGTLLWGQLISTIPTSRLKFLKEAGHGTQKEE
IPEEELAEDVEEIDHAERELRRGQILWFRGLNRIQTQIRVVNAFRSSLYEGLEKPESRSS
IHNFMTHPEFRIEDSEPHIPLIDDTDAEDDAPTKRNSSPPPSPNKNNNAVDSGIHLTIEM
NKSATSSSPGSPLHSLETSL
NT seq 3663 nt   +upstreamnt  +downstreamnt
atgggcgacatggcaaacaactcagttgcttacagtggtgtgaaaaactctttgaaggaa
gctaatcatgatggagactttggaattacgctcgcagagctgcgggctctcatggagctc
aggtccacagatgcattacgaaaaatacaggaaagctatggagatgtctatggaatttgc
accaaattgaaaacatctcccaatgaaggtttaagtggaaaccctgcagatttagaaaga
agagaagcagtgtttggaaagaattttatacctcctaaaaagccaaaaacctttcttcaa
ttagtatgggaagcattacaagatgtcactttaattatattagaaattgcagccatagta
tcattgggcctttctttttatcagcctccagaaggggataatgcactttgtggagaagtt
tctgttggggaggaagaaggtgaaggtgaaactggttggattgaaggagctgcaatcctc
ttgtctgtagtgtgtgtggtgttagtaacagctttcaatgactggagtaaggaaaaacag
tttagaggtttgcagagccgaattgaacaagaacagaagttcactgtcatcaggggtggt
caggtcattcagatacctgtagctgacattactgttggagatattgctcaagtgaaatat
ggtgatcttcttccagctgacggcatacttattcaaggcaacgatcttaaaattgatgaa
agctcattgactggtgaatcagatcatgttaaaaagtctttagataaggatcccttactt
ctatcaggtactcatgtaatggaaggctctggaagaatggtagttacagctgtaggtgta
aattctcaaactggaattatctttaccttacttggagctggaggtgaagaggaagagaag
aaagatgagaagaaaaaggaaaagaaaaataagaaacaagatggagctattgagaatcgc
aacaaagcaaaagcccaggatggtgcagccatggaaatgcagccattgaagagtgaagaa
ggtggagatggtgatgaaaaagataaaaagaaagcaaatttgccaaaaaaggaaaaatct
gttttacaagggaaacttacaaaactggctgttcagattggcaaagcaggtctgttgatg
tctgccatcacagttatcattctagtattatattttgtcattgacaccttctgggttcag
aaaagaccatggcttgctgagtgcacaccaatttatatacaatactttgtgaagttcttc
attattggagttacagttttagtggtcgcagtgccagaaggtcttccacttgcagtcacg
atctcactggcttattcagtcaaaaaaatgatgaaagataataacttagtaaggcatctg
gatgcttgtgaaaccatgggaaatgctacagctatttgttcagataaaacaggaactttg
acaatgaacagaatgacagtcgttcaagcttacataaatgaaaaacattataaaaaggtt
cctgaaccagaagctattccaccaaatattttgtcctatcttgtaacaggaatttctgtg
aattgtgcttatacatcaaaaatattgccaccagagaaagagggtggattacctcgtcac
gttggtaataaaactgaatgtgccttgttgggacttcttttggatttaaaacgggattat
caggatgttagaaatgaaataccagaagaagcactgtacaaagtctacaccttcaattct
gttaggaagtccatgagtactgtcctgaaaaattcagatggaagttatcgaatattcagc
aagggtgcatctgagataattctgaaaaagtgtttcaaaatcttgagtgctaatggtgag
gcaaaagtattcagaccaagggaccgtgatgatattgtaaaaactgtgattgaaccgatg
gcatcagaaggcttgagaaccatatgtcttgcattcagagattttccagcaggagaacca
gaaccagagtgggataatgaaaatgatattgtcaccggccttacatgcattgctgttgtg
gggattgaagatcctgtgagacctgaggtgccagatgcaattaaaaagtgtcagagggct
ggaattactgtgcggatggtcactggtgataatattaatactgctcgggccattgctacc
aaatgtggtattttacatcctggggaagattttctgtgcctagaaggtaaagattttaac
agaagaatacgaaatgaaaaaggagagattgagcaagagaggatagacaagatttggcca
aaacttcgagtacttgcaagatcatctcctactgataagcatacactggttaaaggtata
attgacagcactgtctcagaccaacgccaggttgtagctgtaactggtgatggtacaaat
gatggcccagcactaaagaaagcagatgttggatttgcaatgggtattgctggaactgat
gtagctaaagaagcatccgatattattctcacagatgacaactttacaagcattgttaaa
gcagttatgtggggacgaaatgtctatgacagcatctcaaaattccttcagttccaactt
actgttaatgtagtagcagtgattgttgcttttacgggcgcctgcattactcaagactca
ccgcttaaggctgtgcagatgctgtgggtaaacctcataatggatacactcgcttccctg
gctctggcaacggaaccacccactgagtctctcttgcttcggaaaccttatggtagaaat
aagcctctcatctcacgtacaatgatgaagaatattttgggtcatgcattctatcaactt
gtagtagtctttacactcttatttgctggagaaaagttttttgacattgatagtggaaga
aatgctcctttgcatgctcctccttcagaacattatactattgtttttaatacctttgtg
ctgatgcaacttttcaacgaaataaatgcccggaaaattcatggtgaaagaaatgtattc
gaaggaatctttaacaatgccatcttctgcacaattgttttaggcacttttgtggtacag
ataataattgtgcagtttggtggaaaacctttcagttgttcagaactttcaatagaacag
tggctatggtcaatattcctaggaatgggaacattactctggggccagcttatttcaaca
attccaactagccgtttaaaattcctcaaagaagctggtcatggaacacaaaaggaagaa
atacctgaggaggaattagcagaggatgttgaagagattgatcacgctgaaagggagttg
cggcgtggccaaatcttgtggtttagaggtctgaacagaatccaaacacagattcgagtg
gtgaatgcatttcgtagttctttatatgaagggttagaaaaaccggaatcaagaagttcg
attcacaactttatgacacatcctgagtttaggatagaagattcagagcctcatatcccc
cttattgatgacactgatgccgaagatgatgctcctacaaaacgtaactccagtcctcca
ccctctcccaacaaaaataacaatgctgttgacagtggaattcaccttacaatagaaatg
aacaagtctgctacctcttcatccccaggaagcccactacatagtttggaaacatcactc
tga

DBGET integrated database retrieval system