KEGG   Homo sapiens (human): 4907Help
Entry
4907              CDS       T01001                                 

Gene name
NT5E, CALJA, CD73, E5NT, NT, NT5, NTE, eN, eNT
Definition
(RefSeq) 5'-nucleotidase ecto
  KO
K19970  5'-nucleotidase [EC:3.1.3.5]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa00240  Pyrimidine metabolism
hsa00760  Nicotinate and nicotinamide metabolism
hsa01100  Metabolic pathways
Disease
H00824  Calcification of joints and arteries
Drug target
Oleclumab: D10963
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    4907 (NT5E)
   00240 Pyrimidine metabolism
    4907 (NT5E)
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    4907 (NT5E)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     4907 (NT5E)
CD molecules [BR:hsa04090]
 Proteins
  4907 (NT5E)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Enzymes
  4907 (NT5E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 5_nucleotid_C Metallophos PGA_cap
Motif
Other DBs
NCBI-GeneID: 4907
NCBI-ProteinID: NP_002517
OMIM: 129190
HGNC: 8021
Ensembl: ENSG00000135318
Vega: OTTHUMG00000015139
Pharos: P21589(Tbio)
UniProt: P21589 Q6NZX3
Structure
PDB: 

Position
6q14.3
AA seq 574 aa AA seqDB search
MCPRAARAPATLLLALGAVLWPAAGAWELTILHTNDVHSRLEQTSEDSSKCVNASRCMGG
VARLFTKVQQIRRAEPNVLLLDAGDQYQGTIWFTVYKGAEVAHFMNALRYDAMALGNHEF
DNGVEGLIEPLLKEAKFPILSANIKAKGPLASQISGLYLPYKVLPVGDEVVGIVGYTSKE
TPFLSNPGTNLVFEDEITALQPEVDKLKTLNVNKIIALGHSGFEMDKLIAQKVRGVDVVV
GGHSNTFLYTGNPPSKEVPAGKYPFIVTSDDGRKVPVVQAYAFGKYLGYLKIEFDERGNV
ISSHGNPILLNSSIPEDPSIKADINKWRIKLDNYSTQELGKTIVYLDGSSQSCRFRECNM
GNLICDAMINNNLRHTDEMFWNHVSMCILNGGGIRSPIDERNNGTITWENLAAVLPFGGT
FDLVQLKGSTLKKAFEHSVHRYGQSTGEFLQVGGIHVVYDLSRKPGDRVVKLDVLCTKCR
VPSYDPLKMDEVYKVILPNFLANGGDGFQMIKDELLRHDSGDQDINVVSTYISKMKVIYP
AVEGRIKFSTGSHCHGSFSLIFLSLWAVIFVLYQ
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgtgtccccgagccgcgcgggcgcccgcgacgctactcctcgccctgggcgcggtgctg
tggcctgcggctggcgcctgggagcttacgattttgcacaccaacgacgtgcacagccgg
ctggagcagaccagcgaggactccagcaagtgcgtcaacgccagccgctgcatgggtggc
gtggctcggctcttcaccaaggttcagcagatccgccgcgccgaacccaacgtgctgctg
ctggacgccggcgaccagtaccagggcactatctggttcaccgtgtacaagggcgccgag
gtggcgcacttcatgaacgccctgcgctacgatgccatggcactgggaaatcatgaattt
gataatggtgtggaaggactgatcgagccactcctcaaagaggccaaatttccaattctg
agtgcaaacattaaagcaaaggggccactagcatctcaaatatcaggactttatttgcca
tataaagttcttcctgttggtgatgaagttgtgggaatcgttggatacacttccaaagaa
accccttttctctcaaatccagggacaaatttagtgtttgaagatgaaatcactgcatta
caacctgaagtagataagttaaaaactctaaatgtgaacaaaattattgcactgggacat
tcgggttttgaaatggataaactcatcgctcagaaagtgaggggtgtggacgtcgtggtg
ggaggacactccaacacatttctttacacaggcaatccaccttccaaagaggtgcctgct
gggaagtacccattcatagtcacttctgatgatgggcggaaggttcctgtagtccaggcc
tatgcttttggcaaatacctaggctatctgaagatcgagtttgatgaaagaggaaacgtc
atctcttcccatggaaatcccattcttctaaacagcagcattcctgaagatccaagcata
aaagcagacattaacaaatggaggataaaattggataattattctacccaggaattaggg
aaaacaattgtctatctggatggctcctctcaatcatgccgctttagagaatgcaacatg
ggcaacctgatttgtgatgcaatgattaacaacaacctgagacacacggatgaaatgttc
tggaaccacgtatccatgtgcattttaaatggaggtggtatccggtcgcccattgatgaa
cgcaacaatggcacaattacctgggagaacctggctgctgtattgccctttggaggcaca
tttgacctagtccagttaaaaggttccaccctgaagaaggcctttgagcatagcgtgcac
cgctacggccagtccactggagagttcctgcaggtgggcggaatccatgtggtgtatgat
ctttcccgaaaacctggagacagagtagtcaaattagatgttctttgcaccaagtgtcga
gtgcccagttatgaccctctcaaaatggacgaggtatataaggtgatcctcccaaacttc
ctggccaatggtggagatgggttccagatgataaaagatgaattattaagacatgactct
ggtgaccaagatatcaacgtggtttctacatatatctccaaaatgaaagtaatttatcca
gcagttgaaggtcggatcaagttttccacaggaagtcactgccatggaagcttttcttta
atatttctttcactttgggcagtgatctttgttttataccaatag

DBGET integrated database retrieval system