KEGG   Homo sapiens (human): 4907Help
Entry
4907              CDS       T01001                                 

Gene name
NT5E, CALJA, CD73, E5NT, NT, NT5, NTE, eN, eNT
Definition
(RefSeq) 5'-nucleotidase ecto
  KO
K19970  5'-nucleotidase [EC:3.1.3.5]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa00240  Pyrimidine metabolism
hsa00760  Nicotinate and nicotinamide metabolism
hsa01100  Metabolic pathways
Disease
H00824  Calcification of joints and arteries
Drug target
Oleclumab: D10963
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4907 (NT5E)
   00240 Pyrimidine metabolism
    4907 (NT5E)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    4907 (NT5E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    4907 (NT5E)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    4907 (NT5E)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     4907 (NT5E)
CD molecules [BR:hsa04090]
 Proteins
  4907 (NT5E)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Enzymes
  4907 (NT5E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 5_nucleotid_C Metallophos PGA_cap
Motif
Other DBs
NCBI-GeneID: 4907
NCBI-ProteinID: NP_002517
OMIM: 129190
HGNC: 8021
Ensembl: ENSG00000135318
Vega: OTTHUMG00000015139
Pharos: P21589(Tbio)
UniProt: P21589 Q6NZX3
Structure
PDB: 

Position
6q14.3
AA seq 574 aa AA seqDB search
MCPRAARAPATLLLALGAVLWPAAGAWELTILHTNDVHSRLEQTSEDSSKCVNASRCMGG
VARLFTKVQQIRRAEPNVLLLDAGDQYQGTIWFTVYKGAEVAHFMNALRYDAMALGNHEF
DNGVEGLIEPLLKEAKFPILSANIKAKGPLASQISGLYLPYKVLPVGDEVVGIVGYTSKE
TPFLSNPGTNLVFEDEITALQPEVDKLKTLNVNKIIALGHSGFEMDKLIAQKVRGVDVVV
GGHSNTFLYTGNPPSKEVPAGKYPFIVTSDDGRKVPVVQAYAFGKYLGYLKIEFDERGNV
ISSHGNPILLNSSIPEDPSIKADINKWRIKLDNYSTQELGKTIVYLDGSSQSCRFRECNM
GNLICDAMINNNLRHTDEMFWNHVSMCILNGGGIRSPIDERNNGTITWENLAAVLPFGGT
FDLVQLKGSTLKKAFEHSVHRYGQSTGEFLQVGGIHVVYDLSRKPGDRVVKLDVLCTKCR
VPSYDPLKMDEVYKVILPNFLANGGDGFQMIKDELLRHDSGDQDINVVSTYISKMKVIYP
AVEGRIKFSTGSHCHGSFSLIFLSLWAVIFVLYQ
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgtgtccccgagccgcgcgggcgcccgcgacgctactcctcgccctgggcgcggtgctg
tggcctgcggctggcgcctgggagcttacgattttgcacaccaacgacgtgcacagccgg
ctggagcagaccagcgaggactccagcaagtgcgtcaacgccagccgctgcatgggtggc
gtggctcggctcttcaccaaggttcagcagatccgccgcgccgaacccaacgtgctgctg
ctggacgccggcgaccagtaccagggcactatctggttcaccgtgtacaagggcgccgag
gtggcgcacttcatgaacgccctgcgctacgatgccatggcactgggaaatcatgaattt
gataatggtgtggaaggactgatcgagccactcctcaaagaggccaaatttccaattctg
agtgcaaacattaaagcaaaggggccactagcatctcaaatatcaggactttatttgcca
tataaagttcttcctgttggtgatgaagttgtgggaatcgttggatacacttccaaagaa
accccttttctctcaaatccagggacaaatttagtgtttgaagatgaaatcactgcatta
caacctgaagtagataagttaaaaactctaaatgtgaacaaaattattgcactgggacat
tcgggttttgaaatggataaactcatcgctcagaaagtgaggggtgtggacgtcgtggtg
ggaggacactccaacacatttctttacacaggcaatccaccttccaaagaggtgcctgct
gggaagtacccattcatagtcacttctgatgatgggcggaaggttcctgtagtccaggcc
tatgcttttggcaaatacctaggctatctgaagatcgagtttgatgaaagaggaaacgtc
atctcttcccatggaaatcccattcttctaaacagcagcattcctgaagatccaagcata
aaagcagacattaacaaatggaggataaaattggataattattctacccaggaattaggg
aaaacaattgtctatctggatggctcctctcaatcatgccgctttagagaatgcaacatg
ggcaacctgatttgtgatgcaatgattaacaacaacctgagacacacggatgaaatgttc
tggaaccacgtatccatgtgcattttaaatggaggtggtatccggtcgcccattgatgaa
cgcaacaatggcacaattacctgggagaacctggctgctgtattgccctttggaggcaca
tttgacctagtccagttaaaaggttccaccctgaagaaggcctttgagcatagcgtgcac
cgctacggccagtccactggagagttcctgcaggtgggcggaatccatgtggtgtatgat
ctttcccgaaaacctggagacagagtagtcaaattagatgttctttgcaccaagtgtcga
gtgcccagttatgaccctctcaaaatggacgaggtatataaggtgatcctcccaaacttc
ctggccaatggtggagatgggttccagatgataaaagatgaattattaagacatgactct
ggtgaccaagatatcaacgtggtttctacatatatctccaaaatgaaagtaatttatcca
gcagttgaaggtcggatcaagttttccacaggaagtcactgccatggaagcttttcttta
atatttctttcactttgggcagtgatctttgttttataccaatag

DBGET integrated database retrieval system