KEGG   Homo sapiens (human): 4908Help
Entry
4908              CDS       T01001                                 

Gene name
NTF3, HDNF, NGF-2, NGF2, NT-3, NT3
Definition
(RefSeq) neurotrophin 3
  KO
K04356  neurotrophin 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04722  Neurotrophin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    4908 (NTF3)
   04010 MAPK signaling pathway
    4908 (NTF3)
   04151 PI3K-Akt signaling pathway
    4908 (NTF3)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    4908 (NTF3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    4908 (NTF3)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   4908 (NTF3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NGF Spaetzle
Motif
Other DBs
NCBI-GeneID: 4908
NCBI-ProteinID: NP_002518
OMIM: 162660
HGNC: 8023
Ensembl: ENSG00000185652
Vega: OTTHUMG00000168649
Pharos: P20783(Tbio)
UniProt: P20783
Structure
PDB: 

Position
12p13.31
AA seq 257 aa AA seqDB search
MSILFYVIFLAYLRGIQGNNMDQRSLPEDSLNSLIIKLIQADILKNKLSKQMVDVKENYQ
STLPKAEAPREPERGGPAKSAFQPVIAMDTELLRQQRRYNSPRVLLSDSTPLEPPPLYLM
EDYVGSPVVANRTSRRKRYAEHKSHRGEYSVCDSESLWVTDKSSAIDIRGHQVTVLGEIK
TGNSPVKQYFYETRCKEARPVKNGCRGIDDKHWNSQCKTSQTYVRALTSENNKLVGWRWI
RIDTSCVCALSRKIGRT
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgtccatcttgttttatgtgatatttctcgcttatctccgtggcatccaaggtaacaac
atggatcaaaggagtttgccagaagactcgctcaattccctcattattaagctgatccag
gcagatattttgaaaaacaagctctccaagcagatggtggacgttaaggaaaattaccag
agcaccctgcccaaagctgaggctccccgagagccggagcggggagggcccgccaagtca
gcattccagccggtgattgcaatggacaccgaactgctgcgacaacagagacgctacaac
tcaccgcgggtcctgctgagcgacagcacccccttggagcccccgcccttgtatctcatg
gaggattacgtgggcagccccgtggtggcgaacagaacatcacggcggaaacggtacgcg
gagcataagagtcaccgaggggagtactcggtatgtgacagtgagagtctgtgggtgacc
gacaagtcatcggccatcgacattcggggacaccaggtcacggtgctgggggagatcaaa
acgggcaactctcccgtcaaacaatatttttatgaaacgcgatgtaaggaagccaggccg
gtcaaaaacggttgcaggggtattgatgataaacactggaactctcagtgcaaaacatcc
caaacctacgtccgagcactgacttcagagaacaataaactcgtgggctggcggtggata
cggatagacacgtcctgtgtgtgtgccttgtcgagaaaaatcggaagaacatga

KEGG   Homo sapiens (human): 4909Help
Entry
4909              CDS       T01001                                 

Gene name
NTF4, GLC10, GLC1O, NT-4, NT-4/5, NT-5, NT4, NT5, NTF5
Definition
(RefSeq) neurotrophin 4
  KO
K12457  neurotrophin 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04722  Neurotrophin signaling pathway
Disease
H00612  Primary open angle glaucoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    4909 (NTF4)
   04010 MAPK signaling pathway
    4909 (NTF4)
   04151 PI3K-Akt signaling pathway
    4909 (NTF4)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    4909 (NTF4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    4909 (NTF4)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   4909 (NTF4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NGF Spaetzle
Motif
Other DBs
NCBI-GeneID: 4909
NCBI-ProteinID: NP_006170
OMIM: 162662
HGNC: 8024
Ensembl: ENSG00000225950
Vega: OTTHUMG00000191728
Pharos: P34130(Tbio)
UniProt: P34130 A0A024QZE4
Structure
PDB: 

Position
19q13.33
AA seq 210 aa AA seqDB search
MLPLPSCSLPILLLFLLPSVPIESQPPPSTLPPFLAPEWDLLSPRVVLSRGAPAGPPLLF
LLEAGAFRESAGAPANRSRRGVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEV
LGEVPAAGGSPLRQYFFETRCKADNAEEGGPGAGGGGCRGVDRRHWVSECKAKQSYVRAL
TADAQGRVGWRWIRIDTACVCTLLSRTGRA
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgctccctctcccctcatgctccctccccatcctcctccttttcctcctccccagtgtg
ccaattgagtcccaacccccaccctcaacattgcccccttttctggcccctgagtgggac
cttctctccccccgagtagtcctgtctaggggtgcccctgctgggccccctctgctcttc
ctgctggaggctggggcctttcgggagtcagcaggtgccccggccaaccgcagccggcgt
ggggtgagcgaaactgcaccagcgagtcgtcggggtgagctggctgtgtgcgatgcagtc
agtggctgggtgacagaccgccggaccgctgtggacttgcgtgggcgcgaggtggaggtg
ttgggcgaggtgcctgcagctggcggcagtcccctccgccagtacttctttgaaacccgc
tgcaaggctgataacgctgaggaaggtggcccgggggcaggtggagggggctgccgggga
gtggacaggaggcactgggtatctgagtgcaaggccaagcagtcctatgtgcgggcattg
accgctgatgcccagggccgtgtgggctggcgatggattcgaattgacactgcctgcgtc
tgcacactcctcagccggactggccgggcctga

DBGET integrated database retrieval system