KEGG   Homo sapiens (human): 4914Help
Entry
4914              CDS       T01001                                 

Gene name
NTRK1, MTC, TRK, TRK1, TRKA, Trk-A, p140-TrkA
Definition
(RefSeq) neurotrophic receptor tyrosine kinase 1
  KO
K03176  neurotrophic tyrosine kinase receptor type 1 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04210  Apoptosis
hsa04722  Neurotrophin signaling pathway
hsa04750  Inflammatory mediator regulation of TRP channels
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05216  Thyroid cancer
hsa05230  Central carbon metabolism in cancer
Network
N00009  TRK fusion kinase to RAS-ERK signaling pathway
N00132  Amplified MYCN to transcriptional repression
Disease
H00032  Thyroid cancer
H00043  Neuroblastoma
H00265  Hereditary sensory and autonomic neuropathy (HSAN)
H01836  Congenital pain insensitivity with anhidrosis
Drug target
Entrectinib: D10926
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    4914 (NTRK1)
   04010 MAPK signaling pathway
    4914 (NTRK1)
   04151 PI3K-Akt signaling pathway
    4914 (NTRK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    4914 (NTRK1)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    4914 (NTRK1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    4914 (NTRK1)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    4914 (NTRK1)
   05230 Central carbon metabolism in cancer
    4914 (NTRK1)
   05202 Transcriptional misregulation in cancers
    4914 (NTRK1)
   05216 Thyroid cancer
    4914 (NTRK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    4914 (NTRK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     4914 (NTRK1)
Protein kinases [BR:hsa01001]
 Receptor tyrosine kinases (RTK)
  TRK family [OT]
   4914 (NTRK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase TPKR_C2 I-set LRR_8 Ig_3 Ig_2 LRR_4
Motif
Other DBs
NCBI-GeneID: 4914
NCBI-ProteinID: NP_002520
OMIM: 191315
HGNC: 8031
Ensembl: ENSG00000198400
Vega: OTTHUMG00000041304
Pharos: P04629(Tchem)
UniProt: P04629
Structure
PDB: 

Position
1q23.1
AA seq 796 aa AA seqDB search
MLRGGRRGQLGWHSWAAGPGSLLAWLILASAGAAPCPDACCPHGSSGLRCTRDGALDSLH
HLPGAENLTELYIENQQHLQHLELRDLRGLGELRNLTIVKSGLRFVAPDAFHFTPRLSRL
NLSFNALESLSWKTVQGLSLQELVLSGNPLHCSCALRWLQRWEEEGLGGVPEQKLQCHGQ
GPLAHMPNASCGVPTLKVQVPNASVDVGDDVLLRCQVEGRGLEQAGWILTELEQSATVMK
SGGLPSLGLTLANVTSDLNRKNVTCWAENDVGRAEVSVQVNVSFPASVQLHTAVEMHHWC
IPFSVDGQPAPSLRWLFNGSVLNETSFIFTEFLEPAANETVRHGCLRLNQPTHVNNGNYT
LLAANPFGQASASIMAAFMDNPFEFNPEDPIPVSFSPVDTNSTSGDPVEKKDETPFGVSV
AVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSSLSPTE
GKGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKML
VAVKALKEASESARQDFQREAELLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRF
LRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQ
GLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEI
FTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHAR
LQALAQAPPVYLDVLG
NT seq 2391 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgaggcggacggcgcgggcagcttggctggcacagctgggctgcggggccgggc
agcctgctggcttggctgatactggcatctgcgggcgccgcaccctgccccgatgcctgc
tgcccccacggctcctcgggactgcgatgcacccgggatggggccctggatagcctccac
cacctgcccggcgcagagaacctgactgagctctacatcgagaaccagcagcatctgcag
catctggagctccgtgatctgaggggcctgggggagctgagaaacctcaccatcgtgaag
agtggtctccgtttcgtggcgccagatgccttccatttcactcctcggctcagtcgcctg
aatctctccttcaacgctctggagtctctctcctggaaaactgtgcagggcctctcctta
caggaactggtcctgtcggggaaccctctgcactgttcttgtgccctgcgctggctacag
cgctgggaggaggagggactgggcggagtgcctgaacagaagctgcagtgtcatgggcaa
gggcccctggcccacatgcccaatgccagctgtggtgtgcccacgctgaaggtccaggtg
cccaatgcctcggtggatgtgggggacgacgtgctgctgcggtgccaggtggaggggcgg
ggcctggagcaggccggctggatcctcacagagctggagcagtcagccacggtgatgaaa
tctgggggtctgccatccctggggctgaccctggccaatgtcaccagtgacctcaacagg
aagaacgtgacgtgctgggcagagaacgatgtgggccgggcagaggtctctgttcaggtc
aacgtctccttcccggccagtgtgcagctgcacacggcggtggagatgcaccactggtgc
atccccttctctgtggatgggcagccggcaccgtctctgcgctggctcttcaatggctcc
gtgctcaatgagaccagcttcatcttcactgagttcctggagccggcagccaatgagacc
gtgcggcacgggtgtctgcgcctcaaccagcccacccacgtcaacaacggcaactacacg
ctgctggctgccaaccccttcggccaggcctccgcctccatcatggctgccttcatggac
aaccctttcgagttcaaccccgaggaccccatccctgtctccttctcgccggtggacact
aacagcacatctggagacccggtggagaagaaggacgaaacaccttttggggtctcggtg
gctgtgggcctggccgtctttgcctgcctcttcctttctacgctgctccttgtgctcaac
aaatgtggacggagaaacaagtttgggatcaaccgcccggctgtgctggctccagaggat
gggctggccatgtccctgcatttcatgacattgggtggcagctccctgtcccccaccgag
ggcaaaggctctgggctccaaggccacatcatcgagaacccacaatacttcagtgatgcc
tgtgttcaccacatcaagcgccgggacatcgtgctcaagtgggagctgggggagggcgcc
tttgggaaggtcttccttgctgagtgccacaacctcctgcctgagcaggacaagatgctg
gtggctgtcaaggcactgaaggaggcgtccgagagtgctcggcaggacttccagcgtgag
gctgagctgctcaccatgctgcagcaccagcacatcgtgcgcttcttcggcgtctgcacc
gagggccgccccctgctcatggtctttgagtatatgcggcacggggacctcaaccgcttc
ctccgatcccatggacctgatgccaagctgctggctggtggggaggatgtggctccaggc
cccctgggtctggggcagctgctggccgtggctagccaggtcgctgcggggatggtgtac
ctggcgggtctgcattttgtgcaccgggacctggccacacgcaactgtctagtgggccag
ggactggtggtcaagattggtgattttggcatgagcagggatatctacagcaccgactat
taccgtgtgggaggccgcaccatgctgcccattcgctggatgccgcccgagagcatcctg
taccgtaagttcaccaccgagagcgacgtgtggagcttcggcgtggtgctctgggagatc
ttcacctacggcaagcagccctggtaccagctctccaacacggaggcaatcgactgcatc
acgcagggacgtgagttggagcggccacgtgcctgcccaccagaggtctacgccatcatg
cggggctgctggcagcgggagccccagcaacgccacagcatcaaggatgtgcacgcccgg
ctgcaagccctggcccaggcacctcctgtctacctggatgtcctgggctag

KEGG   Homo sapiens (human): 4915Help
Entry
4915              CDS       T01001                                 

Gene name
NTRK2, EIEE58, GP145-TrkB, OBHD, TRKB, trk-B
Definition
(RefSeq) neurotrophic receptor tyrosine kinase 2
  KO
K04360  neurotrophic tyrosine kinase receptor type 2 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04722  Neurotrophin signaling pathway
hsa05034  Alcoholism
Disease
H00043  Neuroblastoma
Drug target
Entrectinib: D10926
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    4915 (NTRK2)
   04010 MAPK signaling pathway
    4915 (NTRK2)
   04151 PI3K-Akt signaling pathway
    4915 (NTRK2)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    4915 (NTRK2)
 09160 Human Diseases
  09164 Substance dependence
   05034 Alcoholism
    4915 (NTRK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    4915 (NTRK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     4915 (NTRK2)
Protein kinases [BR:hsa01001]
 Receptor tyrosine kinases (RTK)
  TRK family [OT]
   4915 (NTRK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase I-set Ig_3 TPKR_C2 Ig_2 ig LRR_8 LRRNT V-set LRR_5 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 4915
NCBI-ProteinID: NP_001018074
OMIM: 600456
HGNC: 8032
Ensembl: ENSG00000148053
Vega: OTTHUMG00000020120
Pharos: Q16620(Tchem)
UniProt: Q16620 Q5VWE5 Q548C2
Structure
PDB: 

Position
9q21.33
AA seq 822 aa AA seqDB search
MSSWIRWHGPAMARLWGFCWLVVGFWRAAFACPTSCKCSASRIWCSDPSPGIVAFPRLEP
NSVDPENITEIFIANQKRLEIINEDDVEAYVGLRNLTIVDSGLKFVAHKAFLKNSNLQHI
NFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNES
SKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMYWDVGNLVSKHM
NETSHTQGSLRITNISSDDSGKQISCVAENLVGEDQDSVNLTVHFAPTITFLESPTSDHH
WCIPFTVKGNPKPALQWFYNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYT
LIAKNEYGKDEKQISAHFMGWPGIDDGANPNYPDVIYEDYGTAANDIGDTTNRSNEIPST
DVTDKTGREHLSVYAVVVIASVVGFCLLVMLFLLKLARHSKFGMKGPASVISNDDDSASP
LHHISNGSNTPSSSEGGPDAVIIGMTKIPVIENPQYFGITNSQLKPDTFVQHIKRHNIVL
KRELGEGAFGKVFLAECYNLCPEQDKILVAVKTLKDASDNARKDFHREAELLTNLQHEHI
VKFYGVCVEGDPLIMVFEYMKHGDLNKFLRAHGPDAVLMAEGNPPTELTQSQMLHIAQQI
AAGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRDVYSTDYYRVGGHTMLPIRWM
PPESIMYRKFTTESDVWSLGVVLWEIFTYGKQPWYQLSNNEVIECITQGRVLQRPRTCPQ
EVYELMLGCWQREPHMRKNIKGIHTLLQNLAKASPVYLDILG
NT seq 2469 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcctggataaggtggcatggacccgccatggcgcggctctggggcttctgctgg
ctggttgtgggcttctggagggccgctttcgcctgtcccacgtcctgcaaatgcagtgcc
tctcggatctggtgcagcgacccttctcctggcatcgtggcatttccgagattggagcct
aacagtgtagatcctgagaacatcaccgaaattttcatcgcaaaccagaaaaggttagaa
atcatcaacgaagatgatgttgaagcttatgtgggactgagaaatctgacaattgtggat
tctggattaaaatttgtggctcataaagcatttctgaaaaacagcaacctgcagcacatc
aattttacccgaaacaaactgacgagtttgtctaggaaacatttccgtcaccttgacttg
tctgaactgatcctggtgggcaatccatttacatgctcctgtgacattatgtggatcaag
actctccaagaggctaaatccagtccagacactcaggatttgtactgcctgaatgaaagc
agcaagaatattcccctggcaaacctgcagatacccaattgtggtttgccatctgcaaat
ctggccgcacctaacctcactgtggaggaaggaaagtctatcacattatcctgtagtgtg
gcaggtgatccggttcctaatatgtattgggatgttggtaacctggtttccaaacatatg
aatgaaacaagccacacacagggctccttaaggataactaacatttcatccgatgacagt
gggaagcagatctcttgtgtggcggaaaatcttgtaggagaagatcaagattctgtcaac
ctcactgtgcattttgcaccaactatcacatttctcgaatctccaacctcagaccaccac
tggtgcattccattcactgtgaaaggcaaccccaaaccagcgcttcagtggttctataac
ggggcaatattgaatgagtccaaatacatctgtactaaaatacatgttaccaatcacacg
gagtaccacggctgcctccagctggataatcccactcacatgaacaatggggactacact
ctaatagccaagaatgagtatgggaaggatgagaaacagatttctgctcacttcatgggc
tggcctggaattgacgatggtgcaaacccaaattatcctgatgtaatttatgaagattat
ggaactgcagcgaatgacatcggggacaccacgaacagaagtaatgaaatcccttccaca
gacgtcactgataaaaccggtcgggaacatctctcggtctatgctgtggtggtgattgcg
tctgtggtgggattttgccttttggtaatgctgtttctgcttaagttggcaagacactcc
aagtttggcatgaaaggcccagcctccgttatcagcaatgatgatgactctgccagccca
ctccatcacatctccaatgggagtaacactccatcttcttcggaaggtggcccagatgct
gtcattattggaatgaccaagatccctgtcattgaaaatccccagtactttggcatcacc
aacagtcagctcaagccagacacatttgttcagcacatcaagcgacataacattgttctg
aaaagggagctaggcgaaggagcctttggaaaagtgttcctagctgaatgctataacctc
tgtcctgagcaggacaagatcttggtggcagtgaagaccctgaaggatgccagtgacaat
gcacgcaaggacttccaccgtgaggccgagctcctgaccaacctccagcatgagcacatc
gtcaagttctatggcgtctgcgtggagggcgaccccctcatcatggtctttgagtacatg
aagcatggggacctcaacaagttcctcagggcacacggccctgatgccgtgctgatggct
gagggcaacccgcccacggaactgacgcagtcgcagatgctgcatatagcccagcagatc
gccgcgggcatggtctacctggcgtcccagcacttcgtgcaccgcgatttggccaccagg
aactgcctggtcggggagaacttgctggtgaaaatcggggactttgggatgtcccgggac
gtgtacagcactgactactacagggtcggtggccacacaatgctgcccattcgctggatg
cctccagagagcatcatgtacaggaaattcacgacggaaagcgacgtctggagcctgggg
gtcgtgttgtgggagattttcacctatggcaaacagccctggtaccagctgtcaaacaat
gaggtgatagagtgtatcactcagggccgagtcctgcagcgaccccgcacgtgcccccag
gaggtgtatgagctgatgctggggtgctggcagcgagagccccacatgaggaagaacatc
aagggcatccataccctccttcagaacttggccaaggcatctccggtctacctggacatt
ctaggctag

DBGET integrated database retrieval system