KEGG   Homo sapiens (human): 4915Help
Entry
4915              CDS       T01001                                 

Gene name
NTRK2, EIEE58, GP145-TrkB, OBHD, TRKB, trk-B
Definition
(RefSeq) neurotrophic receptor tyrosine kinase 2
  KO
K04360  neurotrophic tyrosine kinase receptor type 2 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04722  Neurotrophin signaling pathway
hsa05034  Alcoholism
Disease
H00043  Neuroblastoma
Drug target
Entrectinib: D10926
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    4915 (NTRK2)
   04010 MAPK signaling pathway
    4915 (NTRK2)
   04151 PI3K-Akt signaling pathway
    4915 (NTRK2)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    4915 (NTRK2)
 09160 Human Diseases
  09164 Substance dependence
   05034 Alcoholism
    4915 (NTRK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    4915 (NTRK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     4915 (NTRK2)
Protein kinases [BR:hsa01001]
 Receptor tyrosine kinases (RTK)
  TRK family [OT]
   4915 (NTRK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase I-set Ig_3 TPKR_C2 Ig_2 ig LRR_8 LRRNT V-set LRR_5 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 4915
NCBI-ProteinID: NP_001018074
OMIM: 600456
HGNC: 8032
Ensembl: ENSG00000148053
Vega: OTTHUMG00000020120
Pharos: Q16620(Tchem)
UniProt: Q16620 Q5VWE5 Q548C2
Structure
PDB: 

Position
9q21.33
AA seq 822 aa AA seqDB search
MSSWIRWHGPAMARLWGFCWLVVGFWRAAFACPTSCKCSASRIWCSDPSPGIVAFPRLEP
NSVDPENITEIFIANQKRLEIINEDDVEAYVGLRNLTIVDSGLKFVAHKAFLKNSNLQHI
NFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNES
SKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMYWDVGNLVSKHM
NETSHTQGSLRITNISSDDSGKQISCVAENLVGEDQDSVNLTVHFAPTITFLESPTSDHH
WCIPFTVKGNPKPALQWFYNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYT
LIAKNEYGKDEKQISAHFMGWPGIDDGANPNYPDVIYEDYGTAANDIGDTTNRSNEIPST
DVTDKTGREHLSVYAVVVIASVVGFCLLVMLFLLKLARHSKFGMKGPASVISNDDDSASP
LHHISNGSNTPSSSEGGPDAVIIGMTKIPVIENPQYFGITNSQLKPDTFVQHIKRHNIVL
KRELGEGAFGKVFLAECYNLCPEQDKILVAVKTLKDASDNARKDFHREAELLTNLQHEHI
VKFYGVCVEGDPLIMVFEYMKHGDLNKFLRAHGPDAVLMAEGNPPTELTQSQMLHIAQQI
AAGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRDVYSTDYYRVGGHTMLPIRWM
PPESIMYRKFTTESDVWSLGVVLWEIFTYGKQPWYQLSNNEVIECITQGRVLQRPRTCPQ
EVYELMLGCWQREPHMRKNIKGIHTLLQNLAKASPVYLDILG
NT seq 2469 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcctggataaggtggcatggacccgccatggcgcggctctggggcttctgctgg
ctggttgtgggcttctggagggccgctttcgcctgtcccacgtcctgcaaatgcagtgcc
tctcggatctggtgcagcgacccttctcctggcatcgtggcatttccgagattggagcct
aacagtgtagatcctgagaacatcaccgaaattttcatcgcaaaccagaaaaggttagaa
atcatcaacgaagatgatgttgaagcttatgtgggactgagaaatctgacaattgtggat
tctggattaaaatttgtggctcataaagcatttctgaaaaacagcaacctgcagcacatc
aattttacccgaaacaaactgacgagtttgtctaggaaacatttccgtcaccttgacttg
tctgaactgatcctggtgggcaatccatttacatgctcctgtgacattatgtggatcaag
actctccaagaggctaaatccagtccagacactcaggatttgtactgcctgaatgaaagc
agcaagaatattcccctggcaaacctgcagatacccaattgtggtttgccatctgcaaat
ctggccgcacctaacctcactgtggaggaaggaaagtctatcacattatcctgtagtgtg
gcaggtgatccggttcctaatatgtattgggatgttggtaacctggtttccaaacatatg
aatgaaacaagccacacacagggctccttaaggataactaacatttcatccgatgacagt
gggaagcagatctcttgtgtggcggaaaatcttgtaggagaagatcaagattctgtcaac
ctcactgtgcattttgcaccaactatcacatttctcgaatctccaacctcagaccaccac
tggtgcattccattcactgtgaaaggcaaccccaaaccagcgcttcagtggttctataac
ggggcaatattgaatgagtccaaatacatctgtactaaaatacatgttaccaatcacacg
gagtaccacggctgcctccagctggataatcccactcacatgaacaatggggactacact
ctaatagccaagaatgagtatgggaaggatgagaaacagatttctgctcacttcatgggc
tggcctggaattgacgatggtgcaaacccaaattatcctgatgtaatttatgaagattat
ggaactgcagcgaatgacatcggggacaccacgaacagaagtaatgaaatcccttccaca
gacgtcactgataaaaccggtcgggaacatctctcggtctatgctgtggtggtgattgcg
tctgtggtgggattttgccttttggtaatgctgtttctgcttaagttggcaagacactcc
aagtttggcatgaaaggcccagcctccgttatcagcaatgatgatgactctgccagccca
ctccatcacatctccaatgggagtaacactccatcttcttcggaaggtggcccagatgct
gtcattattggaatgaccaagatccctgtcattgaaaatccccagtactttggcatcacc
aacagtcagctcaagccagacacatttgttcagcacatcaagcgacataacattgttctg
aaaagggagctaggcgaaggagcctttggaaaagtgttcctagctgaatgctataacctc
tgtcctgagcaggacaagatcttggtggcagtgaagaccctgaaggatgccagtgacaat
gcacgcaaggacttccaccgtgaggccgagctcctgaccaacctccagcatgagcacatc
gtcaagttctatggcgtctgcgtggagggcgaccccctcatcatggtctttgagtacatg
aagcatggggacctcaacaagttcctcagggcacacggccctgatgccgtgctgatggct
gagggcaacccgcccacggaactgacgcagtcgcagatgctgcatatagcccagcagatc
gccgcgggcatggtctacctggcgtcccagcacttcgtgcaccgcgatttggccaccagg
aactgcctggtcggggagaacttgctggtgaaaatcggggactttgggatgtcccgggac
gtgtacagcactgactactacagggtcggtggccacacaatgctgcccattcgctggatg
cctccagagagcatcatgtacaggaaattcacgacggaaagcgacgtctggagcctgggg
gtcgtgttgtgggagattttcacctatggcaaacagccctggtaccagctgtcaaacaat
gaggtgatagagtgtatcactcagggccgagtcctgcagcgaccccgcacgtgcccccag
gaggtgtatgagctgatgctggggtgctggcagcgagagccccacatgaggaagaacatc
aagggcatccataccctccttcagaacttggccaaggcatctccggtctacctggacatt
ctaggctag

DBGET integrated database retrieval system