KEGG   Homo sapiens (human): 4916Help
Entry
4916              CDS       T01001                                 

Gene name
NTRK3, GP145-TrkC, TRKC, gp145(trkC)
Definition
(RefSeq) neurotrophic receptor tyrosine kinase 3
  KO
K05101  neurotrophic tyrosine kinase, receptor type 3 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04722  Neurotrophin signaling pathway
hsa05230  Central carbon metabolism in cancer
Disease
H00043  Neuroblastoma
H01508  Salivary gland cancer
Drug target
Entrectinib: D10926
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    4916 (NTRK3)
 09160 Human Diseases
  09161 Cancers
   05230 Central carbon metabolism in cancer
    4916 (NTRK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    4916 (NTRK3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     4916 (NTRK3)
Protein kinases [BR:hsa01001]
 Receptor tyrosine kinases (RTK)
  TRK family [OT]
   4916 (NTRK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase I-set TPKR_C2 ig Ig_3 LRR_8 Ig_2 C2-set_2 LRRNT LRR_4 LRR_5 Haspin_kinase LRR_6
Motif
Other DBs
NCBI-GeneID: 4916
NCBI-ProteinID: NP_001012338
OMIM: 191316
HGNC: 8033
Ensembl: ENSG00000140538
Vega: OTTHUMG00000148677
Pharos: Q16288(Tchem)
UniProt: Q16288 X5D2R1
Structure
PDB: 

Position
15q25.3
AA seq 839 aa AA seqDB search
MDVSLCPAKCSFWRIFLLGSVWLDYVGSVLACPANCVCSKTEINCRRPDDGNLFPLLEGQ
DSGNSNGNASINITDISRNITSIHIENWRSLHTLNAVDMELYTGLQKLTIKNSGLRSIQP
RAFAKNPHLRYINLSSNRLTTLSWQLFQTLSLRELQLEQNFFNCSCDIRWMQLWQEQGEA
KLNSQNLYCINADGSQLPLFRMNISQCDLPEISVSHVNLTVREGDNAVITCNGSGSPLPD
VDWIVTGLQSINTHQTNLNWTNVHAINLTLVNVTSEDNGFTLTCIAENVVGMSNASVALT
VYYPPRVVSLEEPELRLEHCIEFVVRGNPPPTLHWLHNGQPLRESKIIHVEYYQEGEISE
GCLLFNKPTHYNNGNYTLIAKNPLGTANQTINGHFLKEPFPESTDNFILFDEVSPTPPIT
VTHKPEEDTFGVSIAVGLAAFACVLLVVLFVMINKYGRRSKFGMKGPVAVISGEEDSASP
LHHINHGITTPSSLDAGPDTVVIGMTRIPVIENPQYFRQGHNCHKPDTYVQHIKRRDIVL
KRELGEGAFGKVFLAECYNLSPTKDKMLVAVKALKDPTLAARKDFQREAELLTNLQHEHI
VKFYGVCGDGDPLIMVFEYMKHGDLNKFLRAHGPDAMILVDGQPRQAKGELGLSQMLHIA
SQIASGMVYLASQHFVHRDLATRNCLVGANLLVKIGDFGMSRDVYSTDYYRLFNPSGNDF
CIWCEVGGHTMLPIRWMPPESIMYRKFTTESDVWSFGVILWEIFTYGKQPWFQLSNTEVI
ECITQGRVLERPRVCPKEVYDVMLGCWQREPQQRLNIKEIYKILHALGKATPIYLDILG
NT seq 2520 nt NT seq  +upstreamnt  +downstreamnt
atggatgtctctctttgcccagccaagtgtagtttctggcggattttcttgctgggaagc
gtctggctggactatgtgggctccgtgctggcttgccctgcaaattgtgtctgcagcaag
actgagatcaattgccggcggccggacgatgggaacctcttccccctcctggaagggcag
gattcagggaacagcaatgggaacgccagtatcaacatcacggacatctcaaggaatatc
acttccatacacatagagaactggcgcagtcttcacacgctcaacgccgtggacatggag
ctctacaccggacttcaaaagctgaccatcaagaactcaggacttcggagcattcagccc
agagcctttgccaagaacccccatttgcgttatataaacctgtcaagtaaccggctcacc
acactctcgtggcagctcttccagacgctgagtcttcgggaattgcagttggagcagaac
tttttcaactgcagctgtgacatccgctggatgcagctctggcaggagcagggggaggcc
aagctcaacagccagaacctctactgcatcaacgctgatggctcccagcttcctctcttc
cgcatgaacatcagtcagtgtgaccttcctgagatcagcgtgagccacgtcaacctgacc
gtacgagagggtgacaatgctgttatcacttgcaatggctctggatcaccccttcctgat
gtggactggatagtcactgggctgcagtccatcaacactcaccagaccaatctgaactgg
accaatgttcatgccatcaacttgacgctggtgaatgtgacgagtgaggacaatggcttc
accctgacgtgcattgcagagaacgtggtgggcatgagcaatgccagtgttgccctcact
gtctactatcccccacgtgtggtgagcctggaggagcctgagctgcgcctggagcactgc
atcgagtttgtggtgcgtggcaaccccccaccaacgctgcactggctgcacaatgggcag
cctctgcgggagtccaagatcatccatgtggaatactaccaagagggagagatttccgag
ggctgcctgctcttcaacaagcccacccactacaacaatggcaactataccctcattgcc
aaaaacccactgggcacagccaaccagaccatcaatggccacttcctcaaggagcccttt
ccagagagcacggataactttatcttgtttgacgaagtgagtcccacacctcctatcact
gtgacccacaaaccagaagaagacacttttggggtatccatagcagttggacttgctgct
tttgcctgtgtcctgttggtggttctcttcgtcatgatcaacaaatatggtcgacggtcc
aaatttggaatgaagggtcccgtggctgtcatcagtggtgaggaggactcagccagccca
ctgcaccacatcaaccacggcatcaccacgccctcgtcactggatgccgggcccgacact
gtggtcattggcatgactcgcatccctgtcattgagaacccccagtacttccgtcaggga
cacaactgccacaagccggacacgtatgtgcagcacattaagaggagagacatcgtgctg
aagcgagaactgggtgagggagcctttggaaaggtcttcctggccgagtgctacaacctc
agcccgaccaaggacaagatgcttgtggctgtgaaggccctgaaggatcccaccctggct
gcccggaaggatttccagagggaggccgagctgctcaccaacctgcagcatgagcacatt
gtcaagttctatggagtgtgcggcgatggggaccccctcatcatggtctttgaatacatg
aagcatggagacctgaataagttcctcagggcccatgggccagatgcaatgatccttgtg
gatggacagccacgccaggccaagggtgagctggggctctcccaaatgctccacattgcc
agtcagatcgcctcgggtatggtgtacctggcctcccagcactttgtgcaccgagacctg
gccaccaggaactgcctggttggagcgaatctgctagtgaagattggggacttcggcatg
tccagagatgtctacagcacggattattacaggctctttaatccatctggaaatgatttt
tgtatatggtgtgaggtgggaggacacaccatgctccccattcgctggatgcctcctgaa
agcatcatgtaccggaagttcactacagagagtgatgtatggagcttcggggtgatcctc
tgggagatcttcacctatggaaagcagccatggttccaactctcaaacacggaggtcatt
gagtgcattacccaaggtcgtgttttggagcggccccgagtctgccccaaagaggtgtac
gatgtcatgctggggtgctggcagagggaaccacagcagcggttgaacatcaaggagatc
tacaaaatcctccatgctttggggaaggccaccccaatctacctggacattcttggctag

DBGET integrated database retrieval system