KEGG   Homo sapiens (human): 4919
Entry
4919              CDS       T01001                                 

Gene name
ROR1, NTRKR1, dJ537F10.1
Definition
(RefSeq) receptor tyrosine kinase like orphan receptor 1
  KO
K05122  receptor tyrosine kinase-like orphan receptor 1 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
Disease
H00605  Deafness, autosomal recessive
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    4919 (ROR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    4919 (ROR1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     4919 (ROR1)
Protein kinases [BR:hsa01001]
 Receptor tyrosine kinases (RTK)
  ROR family
   4919 (ROR1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Kringle I-set Ig_3 Fz Ig_2 ig V-set TMEM154 Haspin_kinase
Other DBs
NCBI-GeneID: 4919
NCBI-ProteinID: NP_005003
OMIM: 602336
HGNC: 10256
Ensembl: ENSG00000185483
Vega: OTTHUMG00000009022
Pharos: Q01973(Tbio)
UniProt: Q01973
Structure
PDB: 
6BA5 6BAN 5Z55

Position
1p31.3
AA seq 937 aa
MHRPRRRGTRPPLLALLAALLLAARGAAAQETELSVSAELVPTSSWNISSELNKDSYLTL
DEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRN
LDTTDTGYFQCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACAR
FIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSS
VPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIG
IPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHS
YCRNPGNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEKNKMEILYILVPSVAIPLAIAL
LFFFICVCRNNQKSSSAPVQRQPKHVRGQNVEMSMLNAYKPKSKAKELPLSAVRFMEELG
ECAFGKIYKGHLYLPGMDHAQLVAIKTLKDYNNPQQWTEFQQEASLMAELHHPNIVCLLG
AVTQEQPVCMLFEYINQGDLHEFLIMRSPHSDVGCSSDEDGTVKSSLDHGDFLHIAIQIA
AGMEYLSSHFFVHKDLAARNILIGEQLHVKISDLGLSREIYSADYYRVQSKSLLPIRWMP
PEAIMYGKFSSDSDIWSFGVVLWEIFSFGLQPYYGFSNQEVIEMVRKRQLLPCSEDCPPR
MYSLMTECWNEIPSRRPRFKDIHVRLRSWEGLSSHTSSTTPSGGNATTQTTSLSASPVSN
LSNPRYPNYMFPSQGITPQGQIAGFIGPPIPQNQRFIPINGYPIPPGYAAFPAAHYQPTG
PPRVIQHCPPPKSRSPSSASGSTSTGHVTSLPSSGSNQEANIPLLPHMSIPNHPGGMGIT
VFGNKSQKPYKIDSKQASLLGDANIHGHTESMISAEL
NT seq 2814 nt   +upstreamnt  +downstreamnt
atgcaccggccgcgccgccgcgggacgcgcccgccgctcctggcgctgctggccgcgctg
ctgctggccgcacgcggggctgctgcccaagaaacagagctgtcagtcagtgctgaatta
gtgcctacctcatcatggaacatctcaagtgaactcaacaaagattcttacctgaccctc
gatgaaccaatgaataacatcaccacgtctctgggccagacagcagaactgcactgcaaa
gtctctgggaatccacctcccaccatccgctggttcaaaaatgatgctcctgtggtccag
gagccccggaggctctcctttcggtccaccatctatggctctcggctgcggattagaaac
ctcgacaccacagacacaggctacttccagtgcgtggcaacaaacggcaaggaggtggtt
tcttccactggagtcttgtttgtcaagtttggcccccctcccactgcaagtccaggatac
tcagatgagtatgaagaagatggattctgtcagccatacagagggattgcatgtgcaaga
tttattggcaaccgcaccgtctatatggagtctttgcacatgcaaggggaaatagaaaat
cagatcacagctgccttcactatgattggcacttccagtcacttatctgataagtgttct
cagttcgccattccttccctgtgccactatgccttcccgtactgcgatgaaacttcatcc
gtcccaaagccccgtgacttgtgtcgcgatgaatgtgaaatcctggagaatgtcctgtgt
caaacagagtacatttttgcaagatcaaatcccatgattctgatgaggctgaaactgcca
aactgtgaagatctcccccagccagagagcccagaagctgcgaactgtatccggattgga
attcccatggcagatcctataaataaaaatcacaagtgttataacagcacaggtgtggac
taccgggggaccgtcagtgtgaccaaatcagggcgccagtgccagccatggaattcccag
tatccccacacacacactttcaccgcccttcgtttcccagagctgaatggaggccattcc
tactgccgcaacccagggaatcaaaaggaagctccctggtgcttcaccttggatgaaaac
tttaagtctgatctgtgtgacatcccagcgtgcgattcaaaggattccaaggagaagaat
aaaatggaaatcctgtacatactagtgccaagtgtggccattcccctggccattgcttta
ctcttcttcttcatttgcgtctgtcggaataaccagaagtcatcgtcggcaccagtccag
aggcaaccaaaacacgtcagaggtcaaaatgtagagatgtcaatgctgaatgcatataaa
cccaagagcaaggctaaagagctacctctttctgctgtacgctttatggaagaattgggt
gagtgtgcctttggaaaaatctataaaggccatctctatctcccaggcatggaccatgct
cagctggttgctatcaagaccttgaaagactataacaacccccagcaatggacggaattt
caacaagaagcctccctaatggcagaactgcaccaccccaatattgtctgccttctaggt
gccgtcactcaggaacaacctgtgtgcatgctttttgagtatattaatcagggggatctc
catgagttcctcatcatgagatccccacactctgatgttggctgcagcagtgatgaagat
gggactgtgaaatccagcctggaccacggagattttctgcacattgcaattcagattgca
gctggcatggaatacctgtctagtcacttctttgtccacaaggaccttgcagctcgcaat
attttaatcggagagcaacttcatgtaaagatttcagacttggggctttccagagaaatt
tactccgctgattactacagggtccagagtaagtccttgctgcccattcgctggatgccc
cctgaagccatcatgtatggcaaattctcttctgattcagatatctggtcctttggggtt
gtcttgtgggagattttcagttttggactccagccatattatggattcagtaaccaggaa
gtgattgagatggtgagaaaacggcagctcttaccatgctctgaagactgcccacccaga
atgtacagcctcatgacagagtgctggaatgagattccttctaggagaccaagatttaaa
gatattcacgtccggcttcggtcctgggagggactctcaagtcacacaagctctactact
ccttcagggggaaatgccaccacacagacaacctccctcagtgccagcccagtgagtaat
ctcagtaaccccagatatcctaattacatgttcccgagccagggtattacaccacagggc
cagattgctggtttcattggcccgccaatacctcagaaccagcgattcattcccatcaat
ggatacccaatacctcctggatatgcagcgtttccagctgcccactaccagccaacaggt
cctcccagagtgattcagcactgcccacctcccaagagtcggtccccaagcagtgccagt
gggtcgactagcactggccatgtgactagcttgccctcatcaggatccaatcaggaagca
aatattcctttactaccacacatgtcaattccaaatcatcctggtggaatgggtatcacc
gtttttggcaacaaatctcaaaaaccctacaaaattgactcaaagcaagcatctttacta
ggagacgccaatattcatggacacaccgaatctatgatttctgcagaactgtaa

DBGET integrated database retrieval system